KEGG   Papaver somniferum (opium poppy): 113330345Help
Entry
113330345         CDS       T05758                                 

Definition
(RefSeq) hexokinase-2, chloroplastic-like isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00010  Glycolysis / Gluconeogenesis
psom00051  Fructose and mannose metabolism
psom00052  Galactose metabolism
psom00500  Starch and sucrose metabolism
psom00520  Amino sugar and nucleotide sugar metabolism
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
psom01200  Carbon metabolism
Module
psom_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
psom_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113330345
   00051 Fructose and mannose metabolism
    113330345
   00052 Galactose metabolism
    113330345
   00500 Starch and sucrose metabolism
    113330345
   00520 Amino sugar and nucleotide sugar metabolism
    113330345
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    113330345
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:psom04131]
    113330345
Enzymes [BR:psom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     113330345
Membrane trafficking [BR:psom04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    113330345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 113330345
NCBI-ProteinID: XP_026432942
LinkDB All DBs
Position
Unknown
AA seq 515 aa AA seqDB search
MAIASPSSITVRSYSSLSPVWSVKRVSQSQLRMMAVRSSNSYSLSVSTTSILTNLQNNCA
TPLPILRHVADSMADDMRAGLAVDGGSSLKMILSYVNSLPTGNEDGLFYALDLGGTNFRV
LRLQLGGKSERVVDTEFEQVSIPKQLMSGTSEELFDFIASGLSKFVEKESERFSFPSGKK
REIGFTFSFPVKQIAIDSGILIKWTKGFAVSGTRGKDVVVCLNEAMERKGLDMRVSALVN
DSVGTLAGARYWDDNVMVAVILGTGTNACYVERMDAISKLHCQGDQVPISGSTIINTEWG
AFSKGLPLTDFDKDMDDASINPGEQIFEKTISGMYLGEIVRRVLVKMAEVGNLFDESIPE
KLSTPLVLRTPDLCAMQQDNSSDLKSVGSILSSKFEVQTNLSTRKTVVEVIDTIVKRGGR
LAGAGIVGILQKMEEDSKGVIYGKRTVVAMDGGLYENYPQYREYLQDAVTELLGSDISKN
VIIEHSKDGSGIGAALLAASNSKYINDYQKGEAIL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgcatcaccatcatcaataactgtcagatcatactcatcactgtcaccagta
tggtcagttaaacgagtttcacagtcacagctaaggatgatggccgtcagatcaagtaac
agttatagtctctctgtaagtactacttcgattctaactaaccttcagaataactgtgct
actcctcttcctatacttcgccacgtggcagattcaatggctgatgatatgagagctggt
ctggccgttgatggtggtagttctcttaaaatgattctgagttatgtcaacagcctaccc
actgggaatgaggatgggttgttttacgctttagatcttggagggacaaattttcgtgta
ttaaggctacaattaggtgggaaaagtgaacgtgttgtcgatacagaattcgagcaggtc
tccattcctaaacaacttatgtctggtacctcagaggagttgtttgattttattgcttcg
ggtttgtcgaaattcgtagagaaggaaagtgagagatttagttttccaagtggaaagaaa
agggaaattggctttacattttctttcccagtaaaacagattgccattgattcaggaata
ttgattaaatggacgaaagggtttgctgtttcaggaacgagaggaaaagatgtagttgtt
tgtttgaatgaagcaatggaaagaaaaggacttgatatgcgggtgtctgctttggttaat
gatagtgttggaacgctcgctggagcaaggtattgggacgacaatgtgatggttgctgtc
attttagggactggaacaaatgcttgttatgtagaacgcatggatgctatttcgaaactg
cattgccagggtgaccaagtgcctatatctgggagtacgatcattaatactgagtgggga
gcattttcaaaaggacttcctttaacagattttgataaagatatggatgatgcaagtatt
aatcctggtgagcagatatttgagaagacgatttcgggaatgtacctaggtgaaatcgta
aggagagtattagtaaagatggctgaagtgggaaatttgtttgatgaatctatacccgaa
aagctctcaacacctcttgttctaaggacacctgatctatgtgctatgcaacaagacaac
tccagtgatctcaaatctgtgggctcaattctaagcagcaaatttgaggtacagaccaac
ttaagcacaaggaaaactgttgtagaggtgatcgacaccatagtgaaaagaggagggcgg
ttagctggtgcaggaatagttggaattcttcaaaaaatggaagaagattccaagggagtt
atatacggaaaaaggaccgtggtggccatggatggaggtttatatgaaaattatccacaa
tacagagaatatcttcaagatgcagttactgagttacttggttcagacatctccaaaaat
gtgataatagaacactcgaaggatgggtctggaattggagcagcattattggccgcttct
aattccaagtacattaacgattatcaaaaaggagaagccatcctgtga

DBGET integrated database retrieval system