KEGG   Papaver somniferum (opium poppy): 113335531Help
Entry
113335531         CDS       T05758                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00010  Glycolysis / Gluconeogenesis
psom00053  Ascorbate and aldarate metabolism
psom00071  Fatty acid degradation
psom00280  Valine, leucine and isoleucine degradation
psom00310  Lysine degradation
psom00330  Arginine and proline metabolism
psom00340  Histidine metabolism
psom00380  Tryptophan metabolism
psom00410  beta-Alanine metabolism
psom00561  Glycerolipid metabolism
psom00620  Pyruvate metabolism
psom00903  Limonene and pinene degradation
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113335531
   00053 Ascorbate and aldarate metabolism
    113335531
   00620 Pyruvate metabolism
    113335531
  09103 Lipid metabolism
   00071 Fatty acid degradation
    113335531
   00561 Glycerolipid metabolism
    113335531
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    113335531
   00310 Lysine degradation
    113335531
   00330 Arginine and proline metabolism
    113335531
   00340 Histidine metabolism
    113335531
   00380 Tryptophan metabolism
    113335531
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    113335531
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    113335531
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     113335531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1350 AAA_25
Motif
Other DBs
NCBI-GeneID: 113335531
NCBI-ProteinID: XP_026437347
LinkDB All DBs
Position
Unknown
AA seq 539 aa AA seqDB search
MAARAISSLLFRSPSRISTSIPSPLKAGKNVSLGRVVSRYSTSAALEEPITAPVKVNYTK
LFINGEFVNSASGKTFPTLDPRTGNVIAHVAEGDAEDINRAVAAARKAFDEGPWPKMTAY
ERSRVLLRFADLIDKHTDELAALETWDNGKTYEQAAQIELPMISRIIRYYAGWADKIHGL
TVQADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALATGNSIVLKTAEQTPLSAL
YAAKLLHEAGLPEGVLNVVSGYGPTAGAALASHMDVDKLAFTGSTETGKIVSELAGRSNL
KPVTLELGGKSPFIVCEDADIDKAVEAAHFALFFNQGQCCCAGSRTFAHEKVYDEFVEKS
KARAMKRVVGDPFQSGVEQGPQIDLEQFEKVMNYIKSGVESGATVETGGARFGDKGYYIQ
PTVFSNVQDHMLIAKDEIFGPVQSILKFKDLSEVIRRSNATTYGLAAGVFTQNIDTANTL
TRALRAGTVWINCFDVFDAAIPFGGYKMSGHGREKGVYSLDNYLQVKAVVTSLNNPAWL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcgagcaatttcgtcgcttcttttccgatccccctcaaggattagtacttcg
attccgtcgcctttgaaagcagggaaaaatgtcagcttgggaagagttgtaagtcgatat
agtacttctgctgcacttgaagaaccaattacagcaccagttaaagtaaactacacaaaa
ctctttatcaacggggagtttgtgaattctgcttcaggaaaaacttttccgactctcgac
ccaaggacagggaatgttatcgctcatgttgctgaaggtgatgctgaagatatcaatcgg
gcggttgctgctgctcgcaaggcttttgacgagggcccatggccaaaaatgacagcttat
gaaaggtcaagggtacttttgcgctttgcggatttgattgataaacatactgatgaactt
gcagcacttgagacgtgggacaatggaaagacttatgaacaggcagctcaaattgaacta
ccaatgatctcacgcataattagatattatgccgggtgggcggataagattcatggtctc
acagttcaggctgatggtccgtaccatgtgcaaaccttacatgagccgattggagttgct
ggacaaattattccatggaattttccacttctcatgtttgcgtggaaggttggacccgct
ttagctactggtaacagtattgtcttaaagacagcagaacaaacaccgttgtctgctcta
tatgcggcgaagttgctccatgaagccggccttcctgagggagttctcaatgtagtttct
ggatatggcccaacggctggtgcagcacttgctagtcatatggatgttgacaagcttgct
ttcacaggatcaactgaaactggcaagattgtttctgaactggctggtagaagcaacctt
aagccagtgactctggagcttggagggaaatctccattcattgtgtgtgaagatgccgac
attgacaaggctgtggaagctgcccactttgctctgttctttaaccagggacaatgctgc
tgtgctgggtctcgtacttttgcacatgaaaaagtttatgacgaattcgtagagaaatca
aaggcacgtgctatgaaacgtgttgttggtgatcccttccagagtggtgtcgaacagggt
cctcagattgatttagagcaatttgagaaggttatgaattacataaaatctggtgttgaa
agtggtgctaccgttgaaactggcggtgctagatttggcgacaagggttactatattcag
cctactgtcttctcaaatgtccaggatcacatgttgatcgccaaggatgagatctttgga
cccgtgcagagcatcttgaaattcaaagatcttagcgaggtgatcagaagatcgaacgca
acaacttacggtttggctgcaggagttttcacccagaacatagacacagcaaacaccctg
acgcgtgcactgagagcaggaactgtgtggattaattgcttcgatgtttttgatgcagca
attccttttgggggttacaagatgagtgggcatggcagagagaagggagtttacagtctt
gataactatttgcaagtgaaagctgtggttacttctttgaacaacccagcttggttataa

DBGET integrated database retrieval system