Papaver somniferum (opium poppy): 113338618 Help Entry 113338618         CDS       T05758                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism psom  Papaver somniferum (opium poppy) Pathway psom03083   Polycomb repressive complex psom04120   Ubiquitin mediated proteolysis psom04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:psom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113338618    04120 Ubiquitin mediated proteolysis     113338618   09126 Chromosome    03083 Polycomb repressive complex     113338618  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113338618    04121 Ubiquitin system [BR:psom04121]     113338618    03036 Chromosome and associated proteins [BR:psom03036]     113338618 Membrane trafficking [BR:psom04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     113338618 Ubiquitin system [BR:psom04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      113338618    Cul7 complex      113338618 Chromosome and associated proteins [BR:psom03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      113338618   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      113338618 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  113338618 NCBI-ProteinID:  XP_026439785 LinkDB All DBs Position 1:233541763..233542419 Genome browser AA seq 154 aa AA seqDB search MSSTPAKTITLRSSDEQIFVIGETVALQSKTLELMIADNDNENIVIPLTTITGSILVKVI EYCNKHAEVETSDEDKKIWDVQFVNFGSTQILFDMILAANFLNIKGLLDLTTNIVAEMVK GKTPNEIRRAFNIKDNFTPEEEEEVRRENNWANE NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtcatctacaccagcaaagacgattactctgaggagttctgatgaacagatctttgtt attggggagaccgttgctttgcaatctaaaacccttgagctcatgatagctgataacgat aatgaaaatattgttatccctttgaccaccatcacgggcagtatcttggtaaaggtgatc gaatactgcaacaaacacgctgaagttgagactagtgatgaagataaaaagatttgggat gtacagtttgtgaatttcggtagtacacaaatattattcgacatgatcctggctgcgaat tttcttaacatcaaaggcttgctggacttgacaacgaatatagtggcggagatggtaaaa ggtaaaacaccaaatgagatacgccgggcattcaacattaaagacaacttcacccctgaa gaagaagaagaagttcgcagggaaaataattgggctaatgaatga

DBGET integrated database retrieval system