KEGG   Papaver somniferum (opium poppy): 113345039Help
Entry
113345039         CDS       T05758                                 

Definition
(RefSeq) ribonuclease II, chloroplastic/mitochondrial-like isoform X1
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psom03016]
    113345039
Enzymes [BR:psom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     113345039
Transfer RNA biogenesis [BR:psom03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    113345039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-GeneID: 113345039
NCBI-ProteinID: XP_026444686
LinkDB All DBs
Position
Unknown
AA seq 800 aa AA seqDB search
MSMAVRAINTCSTSRSSSSSTLRCRLYHFSPHNHYHHQNPNKNLGFRFRFPVFRSRELLI
SHGVYKSCSVHTLMDSVLEELEEIRARKRIRAATKVGIASGELLLDKIGKQRPLQKGLLL
EFRKDSERLLLAVAQKPDGKKNWMVTDQNGVTSSIKPQQVTYIIPGVENFNYEEISRFIQ
KADSNLDPTLLEYAWMELLEKQKSVTAEEMAEIIYGSEEPLDSYSAHVLLSKDEIYFSVV
EVKGYRSVYGPRSGEQVEELLRRKEVKEAAEKELQEFAQLLKSAKAMPSSSKPHKESWTL
EEKNRQKIEALEACAIDACKNDDQKKIAGTILKAMGLPKLSSSALKLLISIGYFPVHIDL
DLLKLNVRTKYSDDIISSAEDLLSNSADPDETDRIDLTHLKVYAIDVDEADELDDALSAR
RLQDGRIQVWIHVADATRFIQPGSKVDREALRRATSIFLPTATIPMFPEKLAMEGMSLKQ
GERCSAVTVSVILRHDGSIAEFNIENSVIKPTYMLTYESATELLHLNLEEESELKLLSEV
ASLRLQWRREQGAIDTCSIEPRIKVVNPDDPEPIINLYVENQADPAMRLVSEIMIMCGEA
VATFGSLNNIPLPYRGQPQSNIDTSAFDHLPEGPVRSVALIKCMRAAEMEFRKPARHGIL
GVPGYVQFTSPIRRYMDLLAHYQIKAFLREDPLPFSAGQLEGMASLINMHIKVARRLQNS
SLRYWLVEYMRRQPKQKKFRALILKFIKDRIAGLLLVEVGMQASAVVSIGKQIGDEIEVR
VEEAHPRDDVFSVIEVPQMS
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggctgttcgagcaataaatacttgttcaacatctcgttcttcttcatcttca
acacttcgatgtcgtttatatcatttctctccacacaaccattaccaccaccaaaaccct
aataagaatttagggtttcgttttcgatttcctgtattccgttctagggagttactaatt
agtcatggagtttataagagttgttctgttcatactcttatggatagtgttctggaagaa
cttgaagaaattcgagctaggaaacgaattcgtgctgcaaccaaggtggggattgctagt
ggggagttacttttagataagattggaaagcagcggccgttgcagaaagggttattacta
gagtttcggaaagattctgaaaggttgttactagcagttgctcagaaaccagatggaaag
aagaattggatggtgacagaccagaatggggttacgtcttctattaagccgcagcaagtt
acatatatcatccctggggttgaaaatttcaactacgaggagatatcaagattcattcaa
aaagctgacagtaatttggatccgacattgcttgagtatgcttggatggagcttcttgag
aagcaaaagtctgtcacagctgaagaaatggcagagattatttatggtagtgaggagcct
ctggacagctattcagcacatgttttgctatcgaaagatgaaatttacttcagcgtggtg
gaggtcaagggatatcgttctgtttatggtccacgttctggtgaacaggtcgaagaactt
ctacgcaggaaggaagtgaaggaggctgcagaaaaggaacttcaggagtttgcacagcta
cttaaatctgctaaggctatgcccagctcttctaaaccacacaaagagtcatggacatta
gaagagaaaaaccgccagaagattgaggctctcgaggcttgtgctattgatgcgtgcaaa
aatgatgatcagaagaagatagctgggacgattctcaaagcaatggggttgcctaagctg
tcatcatctgcattaaagcttctcatttctattgggtatttccctgttcacatcgatcta
gatctcttgaaactcaacgtccgtacaaagtactccgatgatataatttcttctgctgaa
gaccttttatccaactctgctgatcctgatgagaccgacagaatagatctgacccacttg
aaggtttatgctattgatgttgatgaagctgacgagcttgatgatgccttaagtgcaaga
aggcttcaggatggtcgcattcaagtttggatacatgttgctgatgcaactagattcatt
cagccagggagcaaggttgacagagaggcattgagaagagccacgtccattttcttgccc
actgccactattcctatgtttcctgagaaacttgcaatggaaggtatgagcttgaagcag
ggagagcgttgcagtgcagtcacagtatctgtaatactgcgccatgacggcagtattgca
gagttcaacatagagaatagtgttatcaaacctacctatatgttgacgtatgagagtgca
actgagttgcttcacttaaaccttgaagaggagtctgaacttaagctgttgtctgaggtt
gcatctcttcgactgcaatggcgtcgcgagcagggtgcaatagacacctgctcaatagaa
ccacggatcaaggtggttaatccagatgacccggaacctataatcaatctctatgtcgaa
aatcaagccgaccctgctatgcgactggtctctgaaatcatgataatgtgtggggaggct
gtagctacttttggttctttgaataacattcctttgccctacagagggcaacctcaatca
aacatcgatacatcagcatttgatcatcttccggaaggacctgttagaagtgttgcttta
atcaaatgcatgcgtgcagcagaaatggaattcaggaagcctgcacgtcatggaatcttg
ggcgttcctggttatgtgcagtttacatctcccatacgcagatatatggatcttcttgct
cattaccagattaaagccttccttagagaagatcctcttcctttttctgctggtcagttg
gaagggatggcatcactgattaacatgcatataaaagtagcaagaagactccagaacagc
agtctaaggtattggttggtagaatatatgagaaggcagcccaagcaaaagaagttccgt
gctttaattcttaagtttattaaagaccggattgcaggtttacttttggttgaggttggg
atgcaagcttctgcagttgtgtcaattgggaaacaaataggagatgaaatagaagttagg
gtagaagaagcccatccacgtgacgatgtcttctccgttattgaagtacctcaaatgtct
tag

DBGET integrated database retrieval system