KEGG   Papaver somniferum (opium poppy): 113353130Help
Entry
113353130         CDS       T05758                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00010  Glycolysis / Gluconeogenesis
psom00051  Fructose and mannose metabolism
psom00052  Galactose metabolism
psom00500  Starch and sucrose metabolism
psom00520  Amino sugar and nucleotide sugar metabolism
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
psom01200  Carbon metabolism
Module
psom_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
psom_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113353130
   00051 Fructose and mannose metabolism
    113353130
   00052 Galactose metabolism
    113353130
   00500 Starch and sucrose metabolism
    113353130
   00520 Amino sugar and nucleotide sugar metabolism
    113353130
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    113353130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:psom04131]
    113353130
Enzymes [BR:psom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     113353130
Membrane trafficking [BR:psom04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    113353130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FimH_man-bind
Motif
Other DBs
NCBI-GeneID: 113353130
NCBI-ProteinID: XP_026452615
LinkDB All DBs
Position
2
AA seq 499 aa AA seqDB search
MKKEVVVVGVVATLATVTATVVLVRRWRRSSESRWRRTQRILRTLASQCATPLSKLEQIA
EELVVDMKSGLSYSDGRSKLPMIISYVDSLPTGYEGGIYYGLNLSGTEFRASRIQLGGKT
ARIVNQESITIPIPPHLSVQSSHQEVFDYIAMEVGTFFSTSNENFPALTQGQNKKLGFTY
SFPVDEDTTSLESGIKWKKFSINDPEGKAMVDDMNKALETHGVNMQVSAMVDETVGNLVG
DRCYNTEVVAAVTLAMGTNAAYIEQKSAVSKWNDPSTTSAEMVIDVEWGSFNSSNLPLTK
EFDVCLDAKSSNPGEQIFEKLISGMYLGEIVRLVLLKMAKETALFGDAVPPKLSNPYVLR
SPDMAAMHQDTSEGREVVGEKLKEIFEITVSTPMVREVVADVCDIVVERAARLAGAGIVS
ILKKLNRTDATQKSVVTVEGGLYQHYRLFRNYLHSCVWEMLGSSENVVIENSNGGSGIGA
VFLAVSNSRPIQESTPPSS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggaagttgtagtggtaggggtggtggcgacactggcaacggtaacagcaacg
gtggtactggtaagaagatggagaaggagtagcgagagtcgttggagacgcacacaacgt
attcttcgaacattggcttcgcaatgtgcaactccattatcaaagttggagcagattgct
gaggaattggtggttgatatgaaatctggtctttcttattctgatggaagaagtaaactt
cctatgatcatttcttacgttgattctcttcccacaggctacgaaggtggaatatactat
ggactgaatttgagtggaactgaatttcgagcatcgcgtattcaactaggaggaaaaaca
gctcgtattgttaaccaagaatcaataactattccaattccaccacacttatctgttcaa
tcttcacaccaggaagtctttgattacattgcgatggaagttggcacattcttctccacg
tcgaatgaaaatttccctgctctaacacaaggacagaataagaaacttggattcacttat
tcgtttcctgttgatgaagacacgacatcactggaatccggaattaagtggaagaagttc
tctatcaatgatccagagggaaaagcaatggtggatgatatgaacaaagccttggaaaca
catggtgtaaacatgcaagtttctgcaatggtggatgagacggttggtaacttggtcggt
gatagatgctataacactgaggttgtagctgctgtcaccctagctatggggactaatgct
gcatatatagagcagaaaagtgcagtttccaagtggaatgatccatcgacaacgtcggca
gagatggttatcgatgtggaatggggaagtttcaattcttctaatcttccgttaacaaaa
gaatttgatgtatgtttagacgctaaaagttctaatcctggtgaacagatttttgagaag
ctcatctcaggaatgtatttgggagaaatagtcagactggtgttgttaaaaatggccaaa
gaaactgctctttttggtgacgctgtccctcctaagctaagcaatccttatgtgttaagg
tctcccgatatggctgccatgcatcaagatacatcagagggccgtgaagttgtcggcgaa
aaattgaaggagatttttgagataacagtttccactccaatggtaagagaggttgtagcg
gacgtttgtgacatagtggtagagcgtgcagcgcgtttagctggagctgggatagtgagt
attttgaaaaaactcaatcggactgatgcaactcaaaaaagtgtagtgacagtagaaggt
ggcttatatcaacactatcgactcttccgaaattatttacatagctgtgtttgggaaatg
cttggaagctctgaaaatgttgttattgagaattctaatggcgggtctggaattggagct
gtttttcttgctgtttcaaactcgagaccaatacaagagagtacccctcctagctcatag

DBGET integrated database retrieval system