KEGG   Papaver somniferum (opium poppy): 113353521
Entry
113353521         CDS       T05758                                 

Definition
(RefSeq) vinorine synthase-like
  KO
K13065  shikimate O-hydroxycinnamoyltransferase [EC:2.3.1.133]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00940  Phenylpropanoid biosynthesis
psom00941  Flavonoid biosynthesis
psom00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    113353521
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    113353521
   00941 Flavonoid biosynthesis
    113353521
Enzymes [BR:psom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.133  shikimate O-hydroxycinnamoyltransferase
     113353521
SSDB
Motif
Pfam: Transferase eIF-3c_N
Other DBs
NCBI-GeneID: 113353521
NCBI-ProteinID: XP_026452878
LinkDB
Position
2
AA seq 464 aa
MKVEVVSKEKIKPSSPTPHHLKTYSLSFLDQLALPIYFPLVLYYTSGSNDDPAKTIIERA
DEFCGVVKKSLAKTLTKFYPLAGKLIDDRFVECNDDGVDYVETEVIGCQLSQLIQHPNVM
PERRKKLLPFNPNEISNSVTPPTLLSVQVNCFKECGGIVIGLYIYHKLADASTLVTFINH
WANIARGIAVGDHDKQIEGPSFSLQSLFPQRVGDSTSYKPPNSVTRDGPPVTKKFVFEGT
RLTDLKRKGKIANENEDFQDQYQPTRVEAVSALLWRCIIDMDQAKNKEEVSSTRACIAGH
AVNMRSRMVPPLPPNSFGNMTCLSIALHTFTNTDSTKKNHQRQNILAGKIRESMKKIDGE
YVKQLQTADTFSNALKIIKNENDFPPSGPRPLMLIFTSWCRFSVYEADFGWGKPIWASIC
TLPLKNMVLLMDTSSGDGIEAWVSLSKEDMYVFERHEELLASIS
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgaaggttgaagttgtttcaaaagagaaaatcaaaccttcttctccaactccgcatcac
ctaaaaacctactccttatcatttcttgatcagcttgctctgccaatttattttcctctt
gttctttactacacgagtggcagcaatgacgaccccgccaagacgatcattgaaagggct
gatgagttttgcggcgtagttaagaaatccttagctaaaacgttaacaaaattctaccct
ttggctggtaagctcattgatgatagatttgtagagtgtaacgatgatggtgttgactac
gtggaaaccgaagtaattggttgtcaactctctcaacttatccaacacccaaatgtcatg
cctgaacgcaggaagaaactccttccctttaatcccaacgaaatttcgaattctgttaca
cctcccacacttctatcagtccaagttaattgcttcaaggaatgtggtggaattgtgata
ggtttgtacatctaccacaagttagctgatgcatctacactcgtcactttcatcaaccac
tgggctaatattgctcgtggtattgctgttggtgatcatgataagcaaatcgagggtcca
agtttctctttgcaatctctttttccacagagagtcggagactcaacgagttacaaaccg
cccaactcggttacaagagacggaccacctgtgacgaagaaattcgtatttgaaggtaca
agattaactgacctcaagagaaaaggtaaaattgcaaacgaaaatgaggattttcaagat
caataccaaccaactcgtgttgaagctgtatcggctttgttatggaggtgcatcatcgat
atggatcaagccaaaaacaaggaggaggtttcttctacaagggcttgcatagcaggtcat
gcagtaaacatgaggtcgagaatggttccaccactgccaccaaattccttcggaaatatg
acttgtttgtcgattgcactacacacctttacgaatactgacagcacaaagaagaaccat
cagcgccaaaatattctggcaggaaaaattagggagtccatgaaaaaaatcgatggagag
tatgtaaaacaactgcaaactgccgacacattctcaaatgccttgaagatcataaagaac
gaaaatgattttcctccgagtggtccaagaccgttgatgctaattttcactagttggtgc
aggttttcagtatatgaagcagattttggttgggggaaaccaatatgggcaagtatttgt
acacttcctttgaagaacatggttttgttaatggataccagttcaggagatggaattgaa
gcatgggtaagcttgagtaaagaagacatgtatgtattcgaacgtcacgaggaacttctt
gcatctatctcttag

DBGET integrated database retrieval system