KEGG   Paeniclostridium sordellii: RSJ16_01385Help
Entry
RSJ16_01385       CDS       T05252                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
psor  Paeniclostridium sordellii
Pathway
psor00240  Pyrimidine metabolism
psor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psor00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RSJ16_01385
Enzymes [BR:psor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RSJ16_01385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK zf-C4_ClpX Mu-like_Com
Motif
Other DBs
NCBI-ProteinID: AUN12950
UniProt: A0A0A1SFI2
LinkDB All DBs
Position
190910..191485
Genome map
AA seq 191 aa AA seqDB search
MYRPINHGYIEVVIGPMYSGKSEELIRRLKRARIAKQNVVVFKPIIDDRYSKEDVVSHSG
YTINAIPIKDSSEMMDYINDDTQVVGIDEVQFFDDKIVDEAIKLADNGVRVIAAGLDMDF
KGEPFGPTPRLLAVAEFVDKIQAICSVCGQPATRSQRLINGEPARYDEPIIQVGAVESYE
ARCRKCHVVKK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgtatagaccaattaatcatgggtacatagaggttgtgataggtcctatgtatagtggc
aaaagtgaggaacttataagaagattaaaaagagctagaattgcaaaacaaaatgtggtt
gtttttaagcctattatagatgatagatatagtaaagaagatgttgtatcacatagtgga
tacacaataaatgctatacctataaaagactcatcagaaatgatggattatataaatgat
gatactcaagttgttggtatagatgaagtacaattttttgatgataaaattgtagatgaa
gctattaagttagctgataatggggtaagggttatagcagcaggattagatatggatttt
aaaggagaaccttttgggccgactccaagacttttagcagtagcagaatttgtagataag
atacaggctatatgttctgtttgtggacaaccagcaacaagatctcaaagacttataaat
ggagaaccagctagatatgatgaacctataatacaagttggagctgttgaaagttatgag
gctagatgtagaaaatgtcatgtagttaaaaagtaa

DBGET integrated database retrieval system