KEGG   Paeniclostridium sordellii: RSJ16_02445Help
Entry
RSJ16_02445       CDS       T05252                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
psor  Paeniclostridium sordellii
Pathway
psor00250  Alanine, aspartate and glutamate metabolism
psor00410  beta-Alanine metabolism
psor00430  Taurine and hypotaurine metabolism
psor00650  Butanoate metabolism
psor01100  Metabolic pathways
psor01110  Biosynthesis of secondary metabolites
psor01120  Microbial metabolism in diverse environments
psor02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:psor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    RSJ16_02445
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RSJ16_02445
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RSJ16_02445
   00430 Taurine and hypotaurine metabolism
    RSJ16_02445
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RSJ16_02445
Enzymes [BR:psor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     RSJ16_02445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AUN13144
LinkDB All DBs
Position
427657..429060
Genome map
AA seq 467 aa AA seqDB search
MLFGRKNKLGDSYETPIFGTTESGSSIPKEELGKDSIAPNIAYRLIKDELMNEGNARLNL
CTFCQTYMEDEATKLMAETLEKNAIDKSEYPQTTEMENRCVNMIANLWHAPEDMNYIGTS
TVGSSEACMLGGMAMKFRWRNRAKKLGMDVTSKRPNLVVSSGYQVCWEKFCVYWDIEMRL
VPMDEEHMSLNIDKVLDYVDDYTIGVVALQGITYTGKFDDIKALDALLEEYNKTAKISVP
IHVDGASGGLFTPFIDPDMEWDFRLKNVVSISTSGHKYGLVYPGIGWVIWKDEEYLPKEL
IFEVSYLGGTMPTMAINFSRSASQVIGQYYNFLRLGFEGYRQIHQRTKEVAMYLSDEIEK
TGLFKIYNNGENLPIVCYRLVDNANVEWTLYDLADRLAMKGWQIPAYPLPINLENTIIQR
IVCRADLSHDMAELFIRDLKAAIKDLNNANVIVHGKEQEKKTYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgttatttggtagaaaaaataaattaggggatagttatgagacaccaatatttgggaca
acagaatctggctctagcatacctaaagaagaactagggaaagattctattgctccaaac
atagcatatagattaataaaagatgaattaatgaatgaaggtaatgcaagacttaaccta
tgtacattctgtcaaacatatatggaagatgaagcaacaaaacttatggcagaaacatta
gagaaaaatgcaatagataaatcagaatatccacaaacaacagaaatggaaaatagatgt
gtaaatatgatagcaaacttatggcatgcgccagaagatatgaactacataggaacatca
acagttggatcatcagaagcatgtatgcttggtggtatggcaatgaagtttagatggaga
aatagagctaagaaattaggaatggatgttacaagtaaaagaccaaacttagtagtatca
tcaggatatcaagtttgttgggaaaaattctgtgtatactgggatatagagatgcgttta
gtaccaatggatgaagaacatatgagtttaaatatagataaagtattagactatgtagat
gattacacaataggggttgtagcattacaaggtataacatatacaggaaaatttgatgat
ataaaagcattagatgcattattagaagaatacaacaaaacagctaaaataagtgtacca
attcacgttgatggtgcatcaggaggattatttactccatttatagatccagatatggaa
tgggactttagattaaaaaatgtagtatcaataagtacatcaggacataaatatggacta
gtttacccaggtataggatgggtaatatggaaagatgaagagtacttaccaaaagaatta
atatttgaagtaagttacttaggaggaacaatgccaacaatggcaataaacttctcaaga
tcagcaagtcaagttataggacaatattataacttcttacgtcttggatttgaaggatac
agacaaatacatcaacgtacaaaagaagtagcaatgtatttatcagatgaaatagaaaaa
acaggattatttaaaatatacaataatggtgaaaacttaccaatagtatgttatagatta
gtagataatgctaatgtagaatggacattatatgatttagcagatagattagcaatgaaa
ggatggcaaatacctgcatatccattaccaataaacttagaaaatactattatacaacgt
atagtatgtagagcagatttaagccatgacatggctgaattatttataagagacttaaaa
gcagccataaaagacctaaataacgcaaatgtaatagtacatggtaaagaacaagaaaag
aaaacatacggttttactcactaa

DBGET integrated database retrieval system