KEGG   Pseudomonas sp. Os17: POS17_1962Help
Entry
POS17_1962        CDS       T04177                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
psos  Pseudomonas sp. Os17
Pathway
psos00071  Fatty acid degradation
psos00280  Valine, leucine and isoleucine degradation
psos00281  Geraniol degradation
psos00310  Lysine degradation
psos00362  Benzoate degradation
psos00380  Tryptophan metabolism
psos00410  beta-Alanine metabolism
psos00640  Propanoate metabolism
psos00650  Butanoate metabolism
psos00903  Limonene and pinene degradation
psos00930  Caprolactam degradation
psos01100  Metabolic pathways
psos01110  Biosynthesis of secondary metabolites
psos01120  Microbial metabolism in diverse environments
psos01130  Biosynthesis of antibiotics
psos01200  Carbon metabolism
psos01212  Fatty acid metabolism
Module
psos_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    POS17_1962 (fadB)
   00650 Butanoate metabolism
    POS17_1962 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    POS17_1962 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    POS17_1962 (fadB)
   00310 Lysine degradation
    POS17_1962 (fadB)
   00380 Tryptophan metabolism
    POS17_1962 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    POS17_1962 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    POS17_1962 (fadB)
   00281 Geraniol degradation
    POS17_1962 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    POS17_1962 (fadB)
   00930 Caprolactam degradation
    POS17_1962 (fadB)
Enzymes [BR:psos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     POS17_1962 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     POS17_1962 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     POS17_1962 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     POS17_1962 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: BAQ73656
UniProt: A0A0D6BFC9
LinkDB All DBs
Position
2149132..2151279
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELNFDLKGESVNKFNRLTLNELRQAVDTIKADASIKGVIVSS
GKDVFIVGADITEFVDNFKLPDAELVAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLE
MCLAADYRVMAASAKIGLPEVKLGIYPGFGGTVRLPRLIGADNAIEWIAAGKENRAEDAL
KVGAVDAVVAPEKLKDAALALVKRAISGEFDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFVKLAKTSAAQSLIGLFLNDQEL
KRKAKAYDEIAKDVKQAAVLGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAAKL
LVGRVDKGRMTAAKMAEVLNGIRPTLSYGDFGNVDLVVEAVVENPKVKQIVLAEVEAQVK
EDTILASNTSTISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSELAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKIMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAVDVLYEAKRLGQKNGKGFYAYETDKKGKQ
KKVADPSVLEVLKPIVYEQREVTDEDIINWMMIPLCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAQFVALADQYADLGALYHPTAKLREMAKNGQSFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgaattg
aatttcgacctcaagggtgagtccgtcaacaagttcaaccgtctaaccctgaacgaactg
cgtcaggctgttgacaccatcaaggcagatgcttcgatcaagggcgtgatcgtcagcagt
ggcaaggacgtgttcatcgtcggcgccgacatcaccgagtttgtcgataacttcaagctg
ccggatgccgagctggtggctggcaacctcgaagccaacaagatcttcagcgatttcgaa
gacctcaatgtgccgaccgttgccgcgatcaatggcatcgccctggggggcggcctggaa
atgtgcctggcagcggattaccgcgtcatggccgccagcgccaagatcggtctgccggaa
gtcaagctgggcatctacccgggcttcggcggtactgtgcgcctgccgcgcctgatcggt
gccgacaacgccatcgagtggatcgccgccggcaaggaaaaccgtgccgaagacgcgctg
aaagtcggtgccgtggatgctgtggttgcacccgagaaactcaaggatgccgctctggcc
ctggtcaagcgcgccatttccggcgagttcgactacaaggccaagcgtcagccgaagctg
gaaaaactcaagctcaacgccattgagcagatgatggcgttcgaaaccgccaagggcttc
gtggctggccaggccggcccgaactacccggcaccggtcgaagcgatcaagaccatccag
aaagcggccaacttcggtcgcgacaaagccctggaagtggaagcagccggtttcgtcaaa
ctggccaagacttcggccgcacaaagcctgatcggtctgttcctcaacgaccaggaattg
aagagaaaggccaaggcctacgacgaaatcgccaaggacgtgaagcaggccgccgtactc
ggcgccggcatcatggggggcggcatcgcctaccagtcggcgtccaaaggcacgccgatc
ctgatgaaggacatcaacgagcacggtatcgagcagggtctggcggaagccgcgaaactg
ctggtgggccgcgttgacaagggtcgcatgaccgccgcgaagatggctgaagtgctcaac
ggcattcgtccgaccctgtcctacggcgatttcggcaacgtcgacctggtggtcgaagcc
gtggtcgagaaccccaaggtcaagcagatcgtgctggccgaagtggaagctcaggtcaag
gaagacaccatcctggcgtccaacacctcgaccatttccatcagcctgctggccaaggcc
ctcaagcgtccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtgatccgtggcgagaagtccagcgagctggccgttgccaccaccgttgcc
tacgccaagaaaatgggcaagaacccgatcgtggtcaacgactgcccgggctttttggtc
aaccgcgtgctgttcccgtatttcggcggcttcgccaagctggtcagcgccggtgtggat
ttcgtacgcatcgacaagatcatggaaaaattcggctggccaatgggcccggcgtacctg
atggacgtggtcggtatcgacaccggccaccacggtcgcgacgtcatggctgaaggtttc
ccggatcgcatgaaggacgaccgccgctcggccgtggacgtgctttatgaggccaagcgc
ctgggacagaagaacggcaagggtttctacgcctacgaaaccgacaagaagggcaagcag
aagaaggttgccgatccatcggtactggaagtgctcaagccgattgtctacgagcagcgt
gaagtcaccgacgaagacatcatcaactggatgatgatcccgctgtgcctggaaaccgtt
cgttgcctggaagacggcatcgtcgaaaccgctgccgaagcggacatgggcctggtctac
ggcattggtttccctccattccgtggcggtgcgctgcgctacatcgattccatcggtgtt
gcccagttcgttgccctggccgaccagtacgccgatctgggcgcgctgtaccacccgacc
gcgaagctgcgtgaaatggccaagaacggccagagcttcttcggttaa

DBGET integrated database retrieval system