KEGG   Pseudomonas sp. Os17: POS17_3203Help
Entry
POS17_3203        CDS       T04177                                 

Definition
(GenBank) trehalose synthase/maltokinase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
psos  Pseudomonas sp. Os17
Pathway
psos00500  Starch and sucrose metabolism
psos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    POS17_3203
Enzymes [BR:psos01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     POS17_3203
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     POS17_3203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C FlgN hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: BAQ74897
UniProt: A0A0D6BII3
LinkDB All DBs
Position
complement(3621838..3625188)
Genome map
AA seq 1116 aa AA seqDB search
MAKKPRTATFIKDPLWYKDAVIYQVHVKSFFDSNNDGIGDFPGLIAKLDYIKDLGVNTLW
LLPFYPSPRRDDGYDIAEYRGVSPDYGTLADVRRFIAEAHKRELRVITELVINHTSDQHP
WFQRARKARPGSAARNFYVWSDDDQKYAGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLSVMRYWLDMGIDGLRLDAIPYLIERDGTHNENLPETHDVLKRIRA
EIDAHYPDRMLLAEANQWPEDTQLYFGQAVNGADGDECHMAFHFPLMPRMYMALAQEDRF
PITDILRQTPEIPAHCQWAIFLRNHDELTLEMVTDKERDYLWNYYAADRRARINLGIRRR
LAPLMERDRRRIELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNG
GFSRADPASLVLPPIMDPLYGYQSVNVETQSGDPHSLLNWTRRMLAVRKQSKAFGRGSLK
MLSPSNRRILAYTREYTDADGHQEIILCVANVSRSAQAAELDLSAFAGRVPVEMLGGNAF
PPIGQLHFLLTLAPYGFYWFVLAAEQQMPSWHVEPAQSLPDFCTLVLKKRLEELLEAPAR
TTLEHEVLPLWLPKRRWFAGKDSAPQALRIAYAVRFGDPRHPVLLSEIEVSGDGQSERYQ
LPFGLLGEEQFGSALPQQLAMARVRRGRQVGLITDAFALDSFVRDVLQALQARTRLQSEA
GSIRFEGSPALDGLGLGAESEVRYLSAEQSNSSVVVGGSLVLKLLRRVSAGVHPELEMGA
FLTAAGFAHISPLLGAVLRCDAQGEDHLLMIAQGYLSNQGDAWEWTQNTLQRAIHDELAD
AMSEQEQHYNALGELREFAGLLGRRLGEMHLLLAAPGSGPDFAPQVSTLKDTQAWNRQVA
GQVERGLQVLKQHQGALSTRDRQWVSRLLQHKAQILGHIQQLAKQLVGGLRIRVHGDLHL
GQVLVVKGDAYLIDFEGEPARSLAERRGKHSPYKDVSGVLRSFDYAAAMAREAPVVDGSP
AAAAARERVLRRYLDQARQAFVQAYRLATATLAHGWQEPGAADAALALFSLEKAAYELAY
EAQNRPTWLHVPLHGLVGLLSELQAFSELERGGEQS
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaaaccccgcaccgcgacctttatcaaggacccgctctggtacaaggacgcg
gtgatctaccaggtgcatgtgaagtcctttttcgattccaacaacgatggaatcggcgac
tttcccgggctgatcgccaagctcgactacatcaaggacctgggggtcaacaccctctgg
ctgttgccgttctacccctcgccacggcgcgacgacggctacgacatcgctgaataccgc
ggggtcagccccgactacggcaccctggccgacgtgcggcgctttatcgccgaggcccac
aagcgcgagctgcgggtgatcaccgaactggtgatcaaccacacctcggaccagcacccc
tggttccaacgggcgcgcaaggccaggcccggttcggcggcgcgcaatttctacgtgtgg
tccgacgacgaccagaagtacgccggcacccggatcatctttctcgacaccgagaagtcc
aactggacctgggacccggtggccggccagtacttctggcaccgcttctattcccaccag
ccggacctcaacttcgacaacccccaggtgatgaaggcggtgctctcggtcatgcgctac
tggctggacatgggcatcgacggcctgcgcctggacgccattccctacctgatcgagcgc
gatggcactcacaacgaaaaccttcccgaaacccacgacgtgctcaagcgcattcgcgcc
gagatcgatgcccactacccggaccgcatgctcctggccgaggccaaccaatggccggaa
gacacccagctgtacttcgggcaggccgtcaacggcgccgacggtgacgagtgccacatg
gcttttcacttcccgctgatgccacgcatgtacatggccctggcccaggaagaccgcttc
ccgatcaccgatatcctgcgccagaccccggagatcccggcccactgccaatgggcgatc
ttcctgcgcaaccacgatgagctgaccctggagatggtcaccgacaaggagcgcgactac
ctgtggaactactacgccgccgaccgccgggcgcggatcaacctgggcatccgccggcgc
ctggcgccgctgatggagcgcgaccggcggcgcatcgagctgctcaacagcctgctgctg
tcgatgcccggcaccccgaccctgtattacggcgacgagatcggcatgggcgacaacatc
tacctgggggaccgcgacggcgtgcgcacgccgatgcagtggtccatcgaccgcaatggc
ggcttctcccgggccgacccggccagcctggtgctgccgccgatcatggacccgctgtat
ggctatcagtcggtcaatgtcgagactcagtccggcgatcctcactccctgctcaactgg
acccggcgcatgctggcggtgcgcaagcagtccaaggcctttggccgtggcagcctgaag
atgctgtcgccgagcaaccggcggatcctggcctacacccgggaatacaccgacgccgac
ggccatcaggaaatcatcctgtgcgtggccaacgtctcgcgcagtgcccaggccgcggag
ctggacctgtcggcgttcgccggcagggtcccggtggaaatgctcggcggtaatgccttt
ccgcccatcggccaattgcactttctgctgaccctggcgccctacggcttttactggttc
gtcctggccgccgagcagcagatgcccagctggcacgtggaaccggcccagagcctgccg
gacttctgcaccctggtcctgaaaaagcgcctcgaagaattgctcgaagccccggcgcgc
accaccctggagcacgaagtgctgcccctctggctgcccaagcgccgctggttcgccggc
aaggacagcgccccgcaagcactgcgcatcgcctacgccgtgcgctttggcgaccctcgg
catccggtgctgctcagcgagatcgaggtcagcggcgacggccagtccgagcgctatcag
ttgcccttcggcctgctcggtgaagagcagttcggcagtgccttgccccagcaactggcc
atggcccgggtgcgccgtgggcgccaggtgggcctgatcaccgatgccttcgccctcgac
agtttcgtgcgcgacgtgctccaggccctgcaggcccgcacccggctgcagagcgaagcc
gggtcgatccgtttcgagggcagcccggccctggatgggctgggcctgggggccgagtcc
gaggtgcgctacctgtcggcggagcagtccaacagttcggtggtggtgggcggcagcctg
gtgctcaagctgctgcgccgggtgtccgccggcgtgcatccggagctggaaatgggcgcc
ttcctcacggccgcgggctttgcccatatctcgcccctgctgggtgcggtgctgcgttgc
gatgcccagggcgaggaccacctgctgatgatcgcccagggctacctgagcaatcagggc
gacgcctgggagtggacgcagaacaccctgcagcgggccatccacgatgagctggcggat
gccatgtccgagcaggagcagcattacaacgcccttggcgaactgcgggagtttgccggg
ctgctgggccggcgcctgggggaaatgcacctgttgctggcggccccgggcagcggcccg
gactttgcaccacaagtgagcacgctcaaggacacccaggcctggaatcggcaggtggcc
gggcaagtggaacgagggttgcaggtgctcaagcagcatcaaggtgcactgagcacccgg
gaccggcagtgggtgagtcgattgttgcagcacaaggcgcagatcctcggtcatatccag
cagctggccaaacagctggtgggcggcctgcgtatccgggtccacggcgatctgcacctg
ggccaggtgctggtggtcaagggtgacgcctacctgatcgacttcgagggcgagccggcg
cggtccctggccgagcgccggggcaagcacagcccgtacaaggacgtcagcggggtgttg
cgctccttcgactatgccgcggccatggcccgcgaggcgccggtggtcgatggctcgccg
gcggccgcggcggcgcgggagcgggtgctgcggcgttacctcgaccaggcgcggcaggcc
tttgtccaggcgtatcggctggcgacggctacgcttgcccatggctggcaggagcccggc
gccgcggatgccgccctggccctgttcagcctggagaaggccgcctatgagttggcctat
gaagcgcaaaaccggcccacctggctccacgtgcccttgcacggcctggtcgggctgttg
agtgagctgcaagctttttccgaacttgagcgtggtggagagcagtcatga

DBGET integrated database retrieval system