KEGG   Pseudomonas sp. Os17: POS17_3343Help
Entry
POS17_3343        CDS       T04177                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
psos  Pseudomonas sp. Os17
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 AraC_binding_2 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: BAQ75037
UniProt: A0A0D6BIX0
LinkDB All DBs
Position
complement(3799210..3800178)
Genome map
AA seq 322 aa AA seqDB search
MSPCALLETRHASTQAVDLDQRLRFWEDYNATTLVGLKCNSYAESGFRARQDNLQLSAMR
LACIVGNQHVVERDSSMIRGVPKESIFVSLVSGSGSFFYQDGACQVLEPGELVVYRTDKP
YLFGFSGAMRQFIFDIPQVQFAERCLKRFDRPLKIGVQTGVQRLLLRTLGERTREFFQQP
LCGEAEAYQEQAFELLASLIAGQAGERPINALSGAYLLAAKQCIQEQLADPSLSCERVAA
QTGISPRHLARLFALEGTVPSRFILEKRLHLARQLLGSPQGAGLDISEIAYRHGFASQAH
FARAFKARYQLTPTEARARESS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtctccatgcgccttgctcgaaacccggcacgccagcacccaggcggtcgacctggac
caacgcctgaggttctgggaggactacaacgccaccaccctggtgggactcaagtgcaat
tcctacgccgagagcggatttcgcgcgcgccaggacaacctgcaactgagcgccatgcgc
ctggcctgcatcgtcggcaaccagcatgtggtggagcgcgacagctcgatgatccgcggc
gtgcccaaggaatcgatcttcgtctcgctggtcagtggcagcggctcgttcttctaccag
gatggcgcctgccaggtcctggaacccggcgagctggtggtctatcgcaccgacaagccc
tacctgttcggcttctccggggcgatgcgccagttcatcttcgacatcccccaggtgcag
ttcgccgagcgctgcctgaaacgcttcgaccggcccctcaagatcggcgtgcagaccggc
gtccagcgcctgttgttgcgcaccctgggcgaacgcacccgggagttcttccagcagccg
ctgtgcggcgaggccgaggcctaccaggaacaggctttcgaactgctggccagcctgatt
gccgggcaggcgggcgagcggccgatcaacgccctgagcggggcctatctgctggcggcc
aagcagtgcatccaggaacaactggccgacccgtccctgagctgcgagcgggtggcggcc
cagaccggcatctctccccggcacctggcccggctgtttgccctggagggtacggtgccc
agtcgcttcatcctggaaaaacgcctgcatctggcccgccaactgctgggcagcccccag
ggcgcgggcctggatatcagcgagattgcctatcgccatggctttgccagccaggcgcac
tttgcccgggcgttcaaggcccgctatcagctgacccccactgaggcccgggcccgggag
tcgtcctag

DBGET integrated database retrieval system