KEGG   Pseudomonas sp. Os17: POS17_3345Help
Entry
POS17_3345        CDS       T04177                                 

Definition
(GenBank) major facilitator family transporter
Organism
psos  Pseudomonas sp. Os17
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr Nuc_H_symport MFS_1_like LacY_symp
Motif
Other DBs
NCBI-ProteinID: BAQ75039
UniProt: A0A0D6BJW4
LinkDB All DBs
Position
3801074..3802339
Genome map
AA seq 421 aa AA seqDB search
MAYKNNKAGYQNTLLGVLFLTFGFVFFDRLALSFLFPFMADELQLSNSHLGMLSSVLALA
WAVSGALVGAWSDRSGRRKPLLIVAVLLFSLCSALSGLVTGFLSLLLFRAIMGLAEGPIL
PLSQSLMVEASSPQRRGLNMGLLQGSAAGLLGAVIGPPVLIALAEAYGWRHAFIVSLLPG
LLIALLIWRFVQPDRPPSAPQVEAHPSQGGGQRLALLQSRNIVLCTLISCVFLTWFIILI
SFTPTFLVKVRDYSPASMGTVMSCLGGAWVVWGFGVPAISDRIGRRPTLVLFSLIAACCP
IALLYATSPWMLGALMLLTYTGLGCFTLFMATIPAETVPREVMATALGMIMGIGELVGGF
VAPTLAGFAADRFGLSIVMWMSCGGALLAALLALFLKETAPAVLARQQRQHTSSVLQGNQ
P
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcttataaaaacaacaaggccggttaccagaacaccttgctcggggtgctgttcctg
accttcggcttcgtctttttcgatcgtctggcgctgtctttcctgttccccttcatggcc
gacgaactgcaattgagcaacagccacctgggcatgctgtcgtcggtactggccctggcc
tgggccgtgtccggggccctggtaggcgcctggtcagaccgcagcggcaggcgcaagccg
ctgctgatcgtcgcggtgctcctgttttccctgtgttcggcgctttccgggctggtcacc
ggcttcctcagcctgctgctgtttcgcgccatcatgggcctggcggaagggccgatcctg
cccttgtcgcaatccttgatggtggaggcttcatcgccccaacgccggggcctgaacatg
ggcctgctgcaaggctcggcggcgggcctgctgggggcggtgatcggcccgccggtgctg
atcgccctggccgaagcctatggctggcgccacgccttcatcgtctcgctgcttccgggg
ctgctgatcgccctgctgatctggcgcttcgtgcagcccgaccggccgcccagcgcgccc
caggtcgaggcgcacccgagccagggcggcggacagcggctggccctgctgcaaagccgc
aatatcgtgctctgcaccctgatcagttgcgtgttcctgacctggttcatcatcctgatt
tcctttaccccgacctttctggtcaaggtccgcgactacagcccggccagcatgggcacg
gtgatgagctgcctgggcggcgcctgggtggtgtggggcttcggcgtgccggcgatctcc
gaccgcatcggccggcgaccgaccctggtgctgttctcgctgatcgccgcctgctgcccg
atcgccctgctctacgccacctcaccctggatgctcggcgcactgatgctgctgacctac
accggcctgggctgcttcaccctgttcatggccaccatcccggcggaaaccgtgccccgg
gaggtgatggccaccgccctgggcatgatcatgggcatcggcgaactggtgggcggcttc
gtcgccccgaccctcgccggcttcgccgccgaccgcttcggcctgtccatcgtcatgtgg
atgtcctgtggcggcgccttgctggcagcgctactggcgctgtttctcaaggaaaccgct
ccggcggtgctggcccgtcaacagcgccagcacacctcctctgtcctgcaaggaaaccag
ccatga

DBGET integrated database retrieval system