KEGG   Pseudomonas sp. Os17: POS17_3346Help
Entry
POS17_3346        CDS       T04177                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
psos  Pseudomonas sp. Os17
Pathway
psos00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:psos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    POS17_3346
Enzymes [BR:psos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     POS17_3346
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     POS17_3346
    1.1.1.-  
     POS17_3346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 DZR
Motif
Other DBs
NCBI-ProteinID: BAQ75040
UniProt: A0A0D6BJC4
LinkDB All DBs
Position
3802336..3803400
Genome map
AA seq 354 aa AA seqDB search
MNALRWHAARDLRLSQVQLRQPGTGEVLLQVAYCGICGSDLHEYADGPHSIPHQEAHPLS
GCRAPLTLGHEFCGQVVALGPGVDPSLLGQRVAVEPEYRCGECQYCRMGQYNLCESMGFI
GLMGDGGFAEQALVPAYMLHRLPERVSFKQAAVLEPAAVAYHALNQSSLLAGDSCVVFGL
GPIGLLLVLLARLRGVERIYAVDLDPERRRLALELGASAALDGADPQLQERLRQLSDGGL
DTAFEAAGSQQTLSHALHCLRKGGEAVLVGLMGQVQLDAFHLVNHELRLLSSVGYRHVYP
ELIELLASGRLDLSRLVTRCLALEQAVEQGFEALLHDKSQIKVLVNPTPALAEA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcactgcgttggcacgccgcccgggacctgcgcctgagccaggtgcaactgcgc
cagcccggcaccggggaagtcctgttgcaggtcgcctactgcggtatctgcggcagcgac
ctgcatgaatacgccgacgggccgcactcgattccccatcaggaggcccatccgctgtca
ggctgccgggcgccactgaccctgggccatgagttctgcggtcaggtggtagccctgggc
cccggtgtcgatccgagcctgctagggcagcgggtggcggtggagccggagtaccgctgc
ggcgaatgccaatactgccgcatgggccagtacaacctctgtgaatccatgggctttatc
ggcctgatgggcgacggcggttttgccgagcaggccctggtgcccgcctacatgctgcac
cggttgccagagcgcgtcagcttcaaacaggccgccgtgctggagccggcggcggtggcc
taccacgccctgaaccagagcagcctgctggccggcgacagttgtgtggtgttcgggctg
gggcccatcggcctgttgctggtcctgctcgcacggctgcggggcgtggagcgtatctac
gccgtggacctggaccccgagcgccggcgcctggccctggaactgggcgccagcgccgcc
ctggacggcgccgacccacagctgcaggagcgcctgcggcaactgagcgacggcggcctc
gacacagccttcgaggccgccggcagccagcagaccctgagtcatgccctgcactgcctg
cgcaagggcggcgaggccgtgctggtgggcctgatgggccaagtgcagttagacgccttc
cacctggtgaaccacgaactgcgcctgctcagcagcgtcggctaccgccatgtgtacccc
gaactgatcgagctgctggccagcggacgcctggacctgtcgcggctggtgacccgctgc
ctggccctggagcaggcggtggaacagggcttcgaggcgctgttgcacgacaagagtcag
atcaaggtgctggtcaacccgacgccggccctggccgaggcctga

DBGET integrated database retrieval system