KEGG   Pseudomonas sp. Os17: POS17_4147Help
Entry
POS17_4147        CDS       T04177                                 

Gene name
ampR
Definition
(GenBank) lysR-type transcriptional regulator AmpR
  KO
K17850  LysR family transcriptional regulator, regulator of gene expression of beta-lactamase
Organism
psos  Pseudomonas sp. Os17
Pathway
psos01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:psos00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    POS17_4147 (ampR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:psos03000]
    POS17_4147 (ampR)
Transcription factors [BR:psos03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    POS17_4147 (ampR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-ProteinID: BAQ75841
UniProt: A0A0D6BLK8
LinkDB All DBs
Position
complement(4641475..4642350)
Genome map
AA seq 291 aa AA seqDB search
MLRPHLPLNALRAFEASARHLSFTRAAIELCVTQAAVSHQVKSLEAQLKVTLFKRLPRGL
MLTSEGETLLPVLRECFDRIAQTLGRFDGGHYREVLTVGAVGTFAVGWLLPRQGDFQARH
PFIDLRLSTNNNRVDVAAEGLDYAIRFGTGAWHGIDALPLLQAPLSVLCVPEIARQLHSP
ADLLGQTLLRSYRTDEWPQWFQAAGLGSNSLLPQSVVFDSSLGMLEAALQGLGVALAPPL
MFARQLASGAVVQPFDIGIVTGSYWLTRLQSRAETSAMSAFKAWLLEAVAA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtcctcatctgcccttgaacgcgctgcgcgccttcgaagcctcggcacgtcat
ttgagcttcacccgcgcggccatcgagctgtgcgtgacccaggcggcggtcagccatcag
gtcaagagcctggaggcccaactcaaggtcaccctgttcaagcgcctgccccgtgggctg
atgctcaccagcgaaggcgagacgctgctgccggtgctgcgcgagtgcttcgaccgcatc
gcccagaccctcgggcggttcgacggcgggcactaccgcgaggtgctgacggtgggcgcc
gtgggcaccttcgcggtcggctggttgctgccgcgccagggggacttccaggcccgccat
ccgttcatcgacttgcgcctgagcaccaacaacaaccgggtggacgtggccgccgagggc
ctggactacgccatccgcttcggcaccggggcctggcacggcatcgatgccctgccactg
ctgcaggcgccgctgtcggtgctgtgcgtgccggagattgcccgccagttgcacagcccg
gcggaccttctgggccagaccctgttgcgttcctaccgcaccgacgagtggccgcagtgg
ttccaggcggcggggctgggcagcaacagcctgttgccccagagcgtggtcttcgactcg
tccctgggcatgctcgaagccgccctgcagggcctgggcgtggccctggcgccgcccttg
atgttcgcgcggcaactggccagtggcgcggtggtgcagccgttcgacatcggcatcgtc
accggcagctattggctgacgcgcttgcagtcacgggcggaaacctccgccatgagcgcc
ttcaaggcctggctgctggaggcggtggccgcctag

DBGET integrated database retrieval system