KEGG   Pseudomonas sp. Os17: POS17_4148Help
Entry
POS17_4148        CDS       T04177                                 

Gene name
ampC
Definition
(GenBank) beta-lactamase
  KO
K01467  beta-lactamase class C [EC:3.5.2.6]
Organism
psos  Pseudomonas sp. Os17
Pathway
psos01501  beta-Lactam resistance
psos02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psos00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    POS17_4148 (ampC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    POS17_4148 (ampC)
Enzymes [BR:psos01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     POS17_4148 (ampC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase CgtA
Motif
Other DBs
NCBI-ProteinID: BAQ75842
UniProt: A0A0D6BL88
LinkDB All DBs
Position
4642577..4643749
Genome map
AA seq 390 aa AA seqDB search
MRQITLTGRGLFGACALLLGASQALAETTPDSALKATVDATIRPLMQQQGIPGMAVAIIV
DGKRHYFNYGVASKDNQRPVDHDTLFEVGSVSKTFTATLAAYAQASGKLALNDNASQYLP
ALRGSAFDGISLLQLGTYTAGGLPLQFPDDVKGEDKTLDYYNTWKPTFSPGTQRLYSNPS
LGLFGYLAARSLGQPFDQLMEQTLFPKLGLKHSYVRVPQDQRSHYAQGYDKQNKPSRVGP
GAMDSEAYGVKTSAADLLQFVAGNLQPGQLDATVQRAIASTQSGYYRVGDMTQGLGWERY
AYPVPLARLLAGNSSAMALEPHPVQWLTPAQAPQADALYNKTGSTNGFGAYVLFVPGKQI
GIVLLANKNYPNEERVKAAHGILSALEAAR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaaataaccttaaccggacggggcctgttcggcgcctgtgccttgcttcttggt
gcctcccaggcactggccgaaaccaccccggacagcgccctgaaagccacggtggacgcc
accatccgtccgttgatgcagcagcagggcatccccgggatggcggtagcgatcatcgtc
gacggcaaacgacattactttaactacggtgtcgcctccaaggacaatcagcgtccggtg
gaccacgacaccctgttcgaggtcggctcggtgagcaagaccttcaccgcgaccctggct
gcctacgcccaggccagcggcaagctggccctcaacgacaacgccagccagtacctgccg
gccctgcgcggcagcgccttcgacggtatcagcctgttgcagctgggcacctacaccgcc
ggcggcctgcccctgcagttccccgacgatgtcaagggcgaagacaagacgctggactac
tacaacacctggaaaccgaccttcagccccggcacccagcgcctgtattccaaccccagc
ctcgggctgttcggctacctggcggcgcgcagcctgggccagccgttcgatcagttgatg
gaacagacgctgtttcccaagctgggcctcaagcacagctacgtccgcgtcccgcaggat
cagcgcagccactacgcccagggctacgacaagcagaacaagccgagtcgggtcggcccc
ggtgccatggacagcgaggcctacggggtcaagaccagcgccgccgacctgctgcagttc
gttgccggcaacctgcaaccggggcagctcgacgccaccgtgcagcgcgccattgccagt
acccagagcggttactaccgggtgggcgacatgacccagggcctgggctgggaacgctat
gcctacccggtgcccctggcgcggctgctggccggcaactcatcggccatggcccttgag
ccgcacccggtgcagtggctgacgccggcccaggcgccacaagccgacgccctgtacaac
aagaccggctccaccaacggcttcggcgcctatgtgctgtttgtccccggcaagcagatc
ggcattgtcctgctggccaacaagaactaccccaacgaagagcgggtcaaggccgcccat
gggattctcagcgcgcttgaggcggcccgctaa

DBGET integrated database retrieval system