KEGG   Pseudomonas sp. Os17: POS17_5039Help
Entry
POS17_5039        CDS       T04177                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psos  Pseudomonas sp. Os17
Pathway
psos00473  D-Alanine metabolism
psos00550  Peptidoglycan biosynthesis
psos01100  Metabolic pathways
psos01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psos00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    POS17_5039 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    POS17_5039 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    POS17_5039 (ddl)
Enzymes [BR:psos01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     POS17_5039 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:psos01011]
 Precursor biosynthesis
  Amino acid ligase
   POS17_5039 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_Ter RimK ATP-grasp_5 GARS_A ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: BAQ76733
UniProt: A0A0D6BNM2
LinkDB All DBs
Position
complement(5643717..5644673)
Genome map
AA seq 318 aa AA seqDB search
MTAAYAKLFSTVAPGDFGRVAVLYGGKSAEREVSLKSGKAVLEALQSGGVNAFGIDVGDD
LLQRLLSEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHAVLSSEADCISAVAELGLPLIVKPAHEGSSIGMAKVTSAPELIDAWKAAST
YDSQVLVEQWIQGPEFTIATLRGQVLPPIALGTPHTFYDYDAKYLASDTQYRIPCGLDST
KEQELMDLTAKACEALGIAGWARADVMQDAQGQFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAASLEARG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgcctacgccaagctgttctccaccgtggccccgggcgacttcggccgggtt
gccgtgctctatggcggcaagagcgccgagcgcgaagtttcgctgaagtccggcaaggcc
gtgcttgaagccctgcagagcggcggcgtgaacgctttcggcatcgacgtcggcgacgat
ctgctgcagcgtctcttgagcgagaagatcgatcgcgccttcatcattcttcacggccgt
ggcggtgaagacggcagcatgcaaggtctgctggagtgcctgggcattccttataccggc
agtggcatcctggcgtcggccctggccatggacaagctgcgcaccaagcaggtgtggcac
agcctgggcattccgacgccgcgtcacgcggtcctgagctcggaagccgactgtatttcc
gcggtggcggaactgggcctgcctttgatcgtcaaaccggctcatgaaggctccagtatc
ggtatggccaaggtgacttccgcgcccgagttgatcgacgcatggaaggcggccagtacc
tacgattcgcaagtgttggtcgagcaatggatccagggtcccgagttcaccatcgcgacc
ctgcgtggtcaggtgctgccaccgatcgccctgggcactcctcacacgttttacgactac
gacgccaagtacctggcttccgatacccagtaccggattccatgcggcctcgatagcacc
aaggaacaggaactgatggacctcacggcgaaagcctgtgaggcgctcggtattgccggt
tgggcacgtgccgatgtgatgcaggacgcccaggggcagttctggttcctggaagtcaac
accgctcccgggatgaccgatcacagtctggtgccgatggccgcccgtgcggccggtctg
gatttccagcagttggtcctggccatcctggcagccagtcttgaggcgagaggttaa

DBGET integrated database retrieval system