KEGG   Pseudomonas sp. Os17: POS17_5832Help
Entry
POS17_5832        CDS       T04177                                 

Definition
(GenBank) ABC transporter substrate-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
psos  Pseudomonas sp. Os17
Pathway
psos02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:psos00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    POS17_5832
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psos02000]
    POS17_5832
Transporters [BR:psos02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    POS17_5832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_11 SBP_bac_8 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: BAQ77526
UniProt: A0A0D6BRC4
LinkDB All DBs
Position
complement(6498335..6499360)
Genome map
AA seq 341 aa AA seqDB search
MFKPLALAAAVLSAVSLNAFAGKTELTVYTALEAEQLKTYKQAFEKANPEVEIKWVRDST
GIITAKLLAEKARPQADAVWGLAASSLAILDQQGMLQSYAPKDLGQIGPNYRDAANPPAW
VGMDVWAATICFNTVEAEKQGLSKPVSWQDLTKPEYKGKIVMPNPASSGTGFLDVSAWLQ
TFGEKQGWQYMDELHQNIGQYVHSGSKPCKLAAAGEFPIGISFEYPAVQLKRQGAPLDIV
LPKEGLGWEIEATAVIKGTPHEEAAKKLADFSASPAAMELYKENFAVLAQPGIAKPQTEL
PADYEQRLIKNDFAWASKNRDQILAEWRKRYDGKSEKVAKQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagcccctggctcttgccgctgccgtcctctctgctgtcagcctgaatgcgttt
gccgggaaaaccgagctgacggtctacaccgcccttgaagccgagcaactgaagacctac
aagcaggccttcgaaaaggccaacccggaggtggagatcaaatgggtgcgtgattccacc
gggatcatcaccgccaagctgctggcggaaaaagcccggccgcaagcggacgcggtctgg
ggcctggcggcgtccagcctggcgatcctcgaccagcagggcatgctgcaaagctatgcg
cccaaggacctgggccagatcggcccgaactaccgcgacgccgccaacccgccggcctgg
gtcggcatggacgtctgggccgcgaccatttgcttcaacaccgtggaggccgagaagcag
ggcctgagcaagccggtgagctggcaggacctgaccaagcccgagtacaagggcaagatc
gtcatgcccaacccggcgtcctcgggcaccggtttcctggatgtcagcgcctggttgcag
accttcggcgagaaacagggctggcagtacatggatgagctgcaccagaacatcggccag
tacgtccattccggctccaagccgtgcaagctggccgctgccggtgaattccccatcggc
atctccttcgaatacccggccgtgcagctcaagcgccagggcgcgccgctggacatcgtc
ctgcccaaggaaggcctgggctgggaaatcgaagccacggcggtgatcaagggcacccct
catgaagaggcggcgaagaagctcgccgacttctccgccagccccgcggccatggagctg
tacaaggaaaacttcgccgtgctggcccagccgggcatcgccaagccgcagaccgaactg
ccggcggactacgagcagcgcctgatcaagaacgacttcgcctgggcctcgaagaaccgc
gaccagatcctcgccgaatggcgcaagcgctatgacggcaagtcggaaaaggtcgccaag
cagtaa

DBGET integrated database retrieval system