KEGG   Pseudomonas sp. Os17: POS17_6035Help
Entry
POS17_6035        CDS       T04177                                 

Gene name
ppkA
Definition
(GenBank) serine/threonine protein kinase PpkA
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
psos  Pseudomonas sp. Os17
Pathway
psos02025  Biofilm formation - Pseudomonas aeruginosa
psos03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psos00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    POS17_6035 (ppkA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    POS17_6035 (ppkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psos01001]
    POS17_6035 (ppkA)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psos02044]
    POS17_6035 (ppkA)
Enzymes [BR:psos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     POS17_6035 (ppkA)
Protein kinases [BR:psos01001]
 Serine/threonine kinases: Other
  Bacterial family
   POS17_6035 (ppkA)
Secretion system [BR:psos02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   POS17_6035 (ppkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH VWA_2 TssR Pkinase_fungal VWA Kinase-like Kdo
Motif
Other DBs
NCBI-ProteinID: BAQ77729
UniProt: A0A0D6BSL9
LinkDB All DBs
Position
complement(6706902..6710003)
Genome map
AA seq 1033 aa AA seqDB search
MDILIPGFDIQGEIGEGAMATVYLATQRSLERKVALKVMAAALAADPSFCERFLREGKTL
ARLSHPHTVTIHDIGNVGELYYMAMEYLPNGTLKERIAAGLTPEQGLAYIRQIASALGYA
HAQGLVHRDVKPANILFRADGTAVLSDFGIAKSLDDRTQFTQAGFAVGTPSYMSPEQARG
QDIDGRADLYALGVVLYEILVGELPYNGTDALSTALAHLTEPLPELPLHHGRYQHILRKL
LAKDPAERYPDAAALLAALDNLPPETAEVEATLIQPLPLPPQAAPQPVTQPVTQSHDLAG
LTPVSIEIPQQAPAAQPAPRREPPQEPPVPPRASNLPPAGSGASEQRRGPLLALAGVAVA
VALAVAGGGYWWLSGDSPAPQPKSPATVGTPPAVVAPPVEQALAADVDGGQRPLLMPGKK
TLFQRVLSKPGASFSSAPGATPDKPVPAFSVLYVYQRKNLDGRSWLRLGAASDGRSAGWL
PAEQVSDWKQSLVLKFTERSGRAPVMFVRQASELERLLADPAAAKNLLLRAQKNPQDEQQ
VLALEPNASAVPQDQFYLLPIFDSKESFDENGQPVQLLNVASIDPGNSPQSISDSSGKPL
PANSPPAAADAFRTAVVLVVDTSVSMQPYIDQVRDVVHELQSKIAERGELDSVSFGLVGF
RNNTSKTPGLEYVTKTLVTLDQGRDPQRFQELVSQVKATSVSSHSFNEDAFAGVMQAVEG
MDWKGYGGRLILLVSDAGALRKNDPYSRTQMNEAEVRQAALGKQIKIYALHLRTDAGKKN
HAQAETQYRVLTADANPKIGDLYIPVPGGDVRKFGERVDEIGTVFADLVHQVRSNQHQEV
PLLAAAPSIAQKSAAIGYAMHMDFLGRKAASQAPQLVSAWTADRDLTNPALPAFQVCVML
TKLQLNDLQQSLKLIVDAARKTQTSPKDFFQEIASASAYMSRDPSALRKGGNLADGGVLG
EYLEGLPYRSKSLNMTQDLWLSLSVAEQEDFIDELDSKIRLYETFHNDLANWVRFGDAEP
GDALYRVPLSTLP
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atggacattctgattcccggttttgacattcagggcgagattggcgaaggcgccatggcc
accgtgtacctggcgacccagcgttccctggaacgcaaggtggcgctcaaggtgatggcc
gcggcgctggccgccgacccgagcttctgcgagcgcttcttgcgcgagggcaagaccctg
gcgcggctgtcgcacccgcacaccgtgaccatccacgacatcggcaatgtcggcgagctg
tactacatggccatggagtacctgcccaacggcaccctcaaagagcgcatcgctgccggg
ctgaccccggagcagggcctggcctatatccgccagatcgcctcggccctgggctatgcc
catgcccaggggctggtgcaccgcgacgtcaagccggccaacatcctgttccgtgccgat
ggcacggcggtgctctcggacttcggcatcgccaagtccctggacgaccgcacccagttc
acccaggccggtttcgccgtgggcacgccgagctacatgagcccggaacaggcccgtggc
caggacatcgacggtcgcgccgacctgtatgccctgggggtggtgctgtatgaaatcctg
gtcggcgagttgccgtacaacggcaccgacgcgctgtccacggccctggcccacctcacc
gagcccttgccggagctgccgctgcaccacgggcgctaccagcacatcctgcgcaagctg
ttggccaaggacccggcggaacgttacccggacgcggcggccttgctggcggccctggac
aacctgccgccggagacggccgaggtcgaggcgacgctgatccagccgttgccgctgccc
cctcaggctgccccccagcctgtaactcagcctgtaactcagagccacgacctggccggg
ctgaccccggtgtcgatcgagattccgcaacaggcgccggcggcccaaccggcgccgcgc
cgcgagccgccccaggaaccgcctgtgccgccgcgcgcgtccaacctgccgccagccggc
agcggggcgtccgaacagcgccgcggcccgctgctggccctggccggggttgccgtggcg
gtggccctggccgtggcgggtggcggttactggtggttgtccggcgacagcccggcgccg
caacccaagagcccggccacggtcggcaccccgcctgccgtggtggcgccgccggtggag
caggcgctggccgcggatgtcgatggcggccagcggccgctgctgatgccgggcaagaag
accctgttccagcgggtgctgagcaagccgggggcgagtttctccagcgcgccgggggcc
acgccggacaagccggtgccggcgttctcggtgctttacgtgtaccagcgcaagaacctc
gacggccgctcctggctgcgcctgggcgccgccagcgatggacgcagcgccggttggctg
ccggccgagcaggtcagcgactggaagcagagcctggtgctgaaattcaccgaacgttcc
ggccgcgcgccggtgatgttcgtgcgccaggccagcgagctggagcgcctgctggcggac
ccggcggcggccaagaacctgctgctcagggcgcagaagaatccccaggacgagcagcag
gtgctggccctggaacccaatgccagcgcggtgccccaggaccagttctacctgctgccg
atcttcgattccaaggaaagcttcgacgagaacggccagccggtgcagttgctcaacgtc
gcctcgattgatccgggcaacagcccgcagagcatcagcgacagcagcggcaagccgttg
ccggcgaacagcccgccggcggccgccgatgccttccgcacggcggtggtgctggtggtg
gatacctcggtgtcgatgcagccgtacatcgatcaggtgcgcgacgtggtgcacgagctg
cagagcaagatcgccgagcgcggcgagctggacagtgtcagcttcggcctggtgggcttt
cgcaacaacaccagcaagaccccgggcctggagtacgtgaccaagaccctggtgaccctg
gaccagggccgcgatccccagcgtttccaggaactggtgagccaggtcaaggccaccagc
gtctccagccactcgttcaacgaagacgcctttgccggggtcatgcaggccgtggaaggc
atggactggaagggctacggcggtcgcctgatcctgctggtcagcgatgccggggccctg
cgcaagaacgatccctacagccgcacccagatgaacgaggcggaagtgcgccaggcggcc
ttgggcaagcagatcaagatctacgccctgcacctgcgcaccgatgccggcaagaagaac
cacgcccaggcggaaacccagtaccgggtgctgaccgccgacgccaacccgaagatcggc
gacctgtacattccggtgcccggtggcgatgtgcgcaagttcggcgagcgggtcgacgag
atcggcacggtgttcgccgatcttgtgcatcaggtgcgcagcaaccagcaccaggaagtc
ccgctgctggcggcggcaccgagcatcgcgcagaaatcggcagccatcggctacgccatg
cacatggactttctcggacgcaaggccgccagccaggcgccgcagctggtcagcgcctgg
accgccgaccgcgacctgaccaacccggcgctgccggcgttccaggtctgcgtgatgctg
accaagctgcagctcaacgacctgcagcagtcgctgaaactgatcgtcgacgcggcgcgc
aagacccagacctcgcccaaggacttcttccaggaaatcgccagtgccagtgcctacatg
agccgcgacccgtcggccctgcgcaagggcggcaacctggccgacggcggtgtgctcggc
gaatacctggaaggcctgccgtaccgcagcaagtcgctgaacatgacccaggacctgtgg
ctgtcgttgagcgtggccgagcaggaggatttcatcgacgagctggattcgaagatccgc
ctctacgaaaccttccacaacgacctggccaactgggtgcgcttcggcgatgccgagccg
ggtgatgccctgtaccgcgttccgttgtcgacgctgccgtga

DBGET integrated database retrieval system