KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_1224Help
Entry
PSPPH_1224        CDS       T00266                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Brite
Enzymes [BR:psp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PSPPH_1224 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AAZ33640
UniProt: Q48M82
LinkDB All DBs
Position
1432196..1432714
Genome map
AA seq 172 aa AA seqDB search
MKPHLWLGLLGVFSLSVQAASLDVPINLVSADGAPKPVGNVTVSETQYGLLFTPNLKDLP
AGIHGFHVHENGSCEAGTKDGKKVAALAAGGHFDPAKTGKHLGPYADGHLGDLPALYVNA
DGTANYPVLAPRLKKISEIKGHALMVHAGGDNHSDHPAPLGGGGDRAACGVI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcatctttggctaggcctgcttggcgttttctccctcagtgtccaggctgca
tcgctggacgttcccatcaatctggtcagcgctgacggcgcgcccaaacctgttggcaac
gtgacggtgagcgaaacacagtacggcttgctgtttaccccgaatctgaaagacttgcct
gcgggcattcacggttttcacgtacatgaaaacggcagctgcgaagccggtacgaaggac
ggcaagaaggtcgctgcgctggccgcaggcggccactttgacccggccaagaccggcaag
catctggggccttacgccgatggccatctaggcgatctgcctgcgttgtacgttaacgcc
gacggcactgcaaactatccggtactggcaccacggttgaagaaaatctccgaaatcaaa
ggccatgcgctgatggttcatgcgggcggcgacaaccattccgaccaccctgcacccttg
ggcggtggcggtgatcgtgcagcctgtggcgtgatctga

DBGET integrated database retrieval system