KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_2266Help
Entry
PSPPH_2266        CDS       T00266                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Brite
KEGG Orthology (KO) [BR:psp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSPPH_2266 (ahpF)
Enzymes [BR:psp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PSPPH_2266 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like FAD_oxidored AlaDh_PNT_C Thi4 Glutaredoxin K_oxygenase FAD_binding_3 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AAZ33105
UniProt: Q48JF3
LinkDB All DBs
Position
2628093..2629655
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTRPIEIVASLDDGAKSQEMLALLNDVISVSKDVTLNDSGNDAR
TPSFSLSSPGHDISLRFAGIPMGHEFTSLVLALLQVGGYPPKVSAETIEQVRALQGEFHF
ETYFSQSCQNCPDVVQALNLMAVLNPGIKHVAIDGALFQDEVTDRKIMSVPSIYLNGELF
GQGRMGLEEILAKIDTGAGARQAEKLNAKQAFDVLVVGGGPAGSAAAVYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQHTEGPKLAVALEEHVKQYEVDIMNLQRADKLIPGAAGEL
HEVKFASGASLKAKTVILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDVQLRADAVLQRKLHSLPNVTVITSAQTTEVTGDEQ
KVNGLRYKNRTTGEEITVPLEGIFVQIGLLPNSEWLKGSIELSPRGEIVVDARGETSVPG
IFAAGDVTVTPYKQIIIALGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaatcctatctggagcgggttactcgcccc
atcgagatcgtcgcgtcccttgatgacggcgcgaagtctcaggaaatgcttgcactgctc
aatgatgtgatcagtgtctccaaagatgtcaccctgaatgacagtggcaacgatgcgcgt
actccgtcgttttcgctgagcagccctggccacgatatcagcctgcgtttcgccggtatc
cccatgggccatgaattcacctcgctggtcctggcactgctgcaagttggcggctacccg
cccaaggtcagtgcggaaacgatcgaacaggttcgcgctcttcaaggcgaattccatttc
gaaacctatttctcgcagtcctgccagaactgcccggacgttgtccaggcattgaacctg
atggcagtactgaaccctggcatcaagcatgtcgctatcgacggtgcactgttccaggac
gaagtcacagatcgcaagatcatgtcggtgcccagcatctatctgaatggcgagctgttc
ggtcagggccgcatgggcctggaagaaattctcgcgaagatcgacaccggtgccggtgcg
cgtcaggcagaaaaactcaacgccaaacaggcttttgatgtgctggtagtcggcggcggc
cctgctggttcggcggctgcggtctacgcagcccgcaaaggcattcgtaccggcgttgca
gccgaacgtttcggcggtcaggtgctcgacaccatggccatcgaaaacttcatttcggta
cagcacaccgagggcccaaaactggccgttgcgctggaagagcacgtcaagcagtacgaa
gtcgacatcatgaacctgcaacgcgccgacaagctgattccgggcgcggccggtgagctg
cacgaagttaaatttgccagcggtgccagcctcaaggccaagaccgtcattcttgccacc
ggtgcacgctggagggagatgaacgtaccgggcgaacagcagtaccgtaacaagggcgtg
gcttattgcccgcactgcgacggtccattgttcaagggcaagcgcgttgccgtgattggt
ggcggtaactcgggtgtcgaggcggcaatcgatctggcgggtatcgtgtcacacgtgacg
ctgctggagttcgatgtgcaactgcgtgccgatgccgtcttgcagcgcaaactgcacagc
ctgcccaacgttaccgtgatcaccagtgcgcaaaccactgaggtgaccggcgatgagcag
aaggtcaacggcctgcgttacaagaaccgcaccaccggcgaagaaatcaccgtgccgctg
gaaggtatcttcgtgcagatcggcctgctgcctaacagcgaatggctcaaaggctccatc
gagctgtcgccgcgtggtgagatcgtggtcgatgcacgtggtgaaacctcggtgccgggc
atcttcgctgccggtgacgtgacggtaactccgtacaagcagatcatcatcgccctgggc
gagggtgccaaagcctccctgagtgcctttgaccacctgatccgtacctccgcaccggcc
tga

DBGET integrated database retrieval system