KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_2325Help
Entry
PSPPH_2325        CDS       T00266                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psp01100  Metabolic pathways
psp01110  Biosynthesis of secondary metabolites
psp01130  Biosynthesis of antibiotics
psp01230  Biosynthesis of amino acids
psp02024  Quorum sensing
Module
psp_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:psp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSPPH_2325
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PSPPH_2325
Enzymes [BR:psp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     PSPPH_2325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AAZ34025
UniProt: Q48JA0
LinkDB All DBs
Position
complement(2700873..2701955)
Genome map
AA seq 360 aa AA seqDB search
MNSSVAVKPSDLSSHAVALADNSPSSKRLPGTLELKMRLPLNAALTEKVAAHRRAVRAIL
EGEDSRLLVIVGPCSIHDPQSAREYAERLAGLAAQVSDQMLPVMRAYVEKPRTTVGWKGL
AYDPHLDGSDDMAEGLTLSRQLMRDMLEMGLPIATEILQPMAAGYFDDLLSWVAIGARTT
ESQIHREMASGLPMAVGFKNGTDGGVAVASDAMRSAAHPHRHFGMDGHGHPAIIQTQGNP
DTHIVLRGGHSGPNYDGQSVARVQASLTKNNIASRIMVDCSHANSGKDPSRQPHVFNDVL
EQRLAGNTSLIGMMIESHLFDGCQPLGDRLQYGVSVTDGCLGWEGTEQLLRRAVDRLRYR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgtccgttgccgtaaaaccgtccgacctgtccagccatgccgttgctctggca
gacaacagcccctcctcaaaacgtctgcccggcacgcttgaactgaaaatgcgcctgcca
ctgaatgcagcgctgaccgaaaaggttgctgcccatcgccgcgccgtacgcgccatcctt
gaaggtgaagactcgcgactgctcgttatcgtgggtccctgctcgatccatgacccgcaa
tctgctcgtgaatacgccgagcgactggccggccttgcggcacaagtcagtgatcagatg
ctgccggtgatgcgcgcctacgtcgaaaaaccgcgcacgacagtgggctggaaaggcctg
gcgtacgatccccatctggacggcagtgacgatatggctgaaggcctgacgctgtcgcga
caactgatgcgtgacatgctggaaatgggtctgccgattgccaccgagatactgcaaccc
atggccgcgggctatttcgatgacctgctcagttgggtcgcgatcggcgcacgtaccacc
gagtcgcaaatccatcgggaaatggccagcgggctgcccatggcagtcggcttcaagaat
ggcactgacggtggcgtcgcggtggccagcgatgcaatgcgttcagcggcgcatccgcat
cgccacttcggcatggacggtcacggtcatccggcaatcatccagacgcagggcaatccg
gacactcacattgtgctgcgcggcggccacagcggccccaactacgatggccagagtgtc
gctcgggtgcaggccagcctgaccaaaaacaatatcgcatcgcgaatcatggtcgattgc
agccacgccaacagtggcaaggacccgtcacgccagccccacgtctttaacgatgttctt
gaacagcgcctggccggcaatacctcactgatcggcatgatgatcgagagccatttgttc
gatggctgtcagccgctgggggacaggctgcagtacggcgtgtcggtcaccgatggctgc
cttggctgggaaggcacagaacagctattgcgtcgcgcggttgaccgtctgcgttacaga
taa

DBGET integrated database retrieval system