KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_2647Help
Entry
PSPPH_2647        CDS       T00266                                 

Definition
(GenBank) trehalose synthase/probable maltokinase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00500  Starch and sucrose metabolism
psp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSPPH_2647
Enzymes [BR:psp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PSPPH_2647
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PSPPH_2647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AAZ36893
UniProt: Q48IE3
LinkDB All DBs
Position
3063462..3066788
Genome map
AA seq 1108 aa AA seqDB search
MAKKPGDATFIKDPLWYKDAVIYQVHVKSFFDSNNDGIGDFAGLIEKLDYIAALGVNTIW
LLPFYPSPRRDDGYDISEYRDVHSDYGTMADAKRFIAQAHKRGLRVISELVINHTSDQHP
WFQKARHAKPGSKARDFYVWSDTDQKYDGTRIIFLDTETSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPHVLDAVLEVMRFWLDLGIDGLRLDAIPYLIERDGTNNENLPETHQVLKRIRA
EIDANYPDRMLLAEANQWPEDTQLYFGDSKGPDGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPENCQWAIFLRNHDELTLEMVTDRERDYLWNYYAADRRARINLGIRRRL
APLVDRDRRRVELLNSMLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRADPASLVLPPIMDPMYGFQSVNVEIQERDPHSLLNWNRRMLAVRKQQKAFGRGTLKM
LSPSNRRILAYTREYTAPDGHSEVVLCVANVSSAAQAAELELSAYAGTVPVEMLGGSAFP
PIGQLSYLLTLPPYGFYWFLLASENQMPSWHVEPAQSMPDFPTLVLKKRLEELLEEPLRS
TMEKTSLAVYLPKRRWFAGKGKDIEQVNIAYAVRFGDEAHPVLLSEIEVTADGQTDRYQL
PFGLLAEDDISSALPQQLALARVRRNRDVGLITDAFTLETFIRAVILGMQSDTVIPCADG
ELRFEQSSQLAPLALTAESEVRYLSAEQSNSSAVVGGSLVLKLIRKVSAGTHPELEMGAF
LTNAGFKNISPLLGSVVRVGNDGKPNLLMIAQGYLSNQGDAWEWTQNNLERAVRDELAHG
VSGQEQHYNALLELADFSRSLGQRLGEMHQILASPTDNSDFAVEVTSSQDSKASGTSVNA
QLERALQLLEQRKGDLEQDDQQLVSDLLAQRKQIRRRVEGLAKRSAGGLRIRVHGDLHLG
QVLVVKGDAYLIDFEGEPARALEERRAKHSPFKDVSGVLRSFDYAAAMAVRSAQNVDTSP
EAAGARKRVAETYLAQAREAFIEGYRSATSGMAHAWKDAKGEDAALELFTLEKAAYEVIY
EAENRPAWLAVPLQGLRGLLQPSDGEPI
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaagcccggtgacgcgacattcatcaaagacccgctctggtacaaggatgcg
gtgatttaccaggttcatgtgaaatcgttcttcgattccaataacgacgggatcggcgat
ttcgcgggcttgatcgaaaagctcgactacattgccgcgctgggggtcaacactatctgg
ttgctgccgttctacccgtcgccgcgccgggacgatggctacgatatttccgaataccgc
gatgtgcatagcgattacggcaccatggccgatgccaagcgcttcattgcccaggcgcac
aagcgtggcctgcgggtgatcagtgagctggttatcaaccatacgtccgaccagcacccg
tggtttcagaaagcgcgtcatgccaagcccggctccaaggcacgggatttctatgtctgg
tcggacaccgaccagaagtacgacggcacgcggatcatttttctcgacacagaaacgtcc
aactggacctgggacccggtcgccgggcaatacttctggcaccgcttttactcgcatcag
ccggacctgaacttcgacaacccgcacgtgctggatgcggtactggaagtcatgcgcttc
tggctggatctgggcattgacggcttgcgtctggatgccattccgtacctcatcgaacgg
gacggcaccaacaacgagaacctgccggaaacccatcaggtgctcaagcgcatccgtgcc
gagatcgacgctaattatccggaccgcatgctgctggccgaggccaaccaatggccggaa
gacacccaactgtattttggcgacagcaaaggcccggatggcgatgaatgtcacatggct
tttcactttccgttgatgccgcgcatgtacatggcgctggctcaggaagatcgttttccg
atcaccgatatcttgcggcagacgccggagattccggaaaactgccagtgggcgattttc
ctgcgcaaccacgatgaactgaccctggaaatggtcaccgatcgtgagcgtgattatctg
tggaattactacgccgccgaccgccgtgcacggatcaacctgggtattcgtcggcgcctg
gcgccgttggtggatcgcgaccgccgtcgggtcgagttgctcaacagcatgttgttgtcg
atgcccggcacaccgacgctgtattacggcgacgagatcggcatgggcgataacatctac
ctgggcgaccgggacggtgtgcgcacgcccatgcaatggtccatcgaccgcaacggcggc
ttttcgcgggccgacccggccagcctggtattgccgccgatcatggacccgatgtacggc
tttcagtcggtcaacgtcgaaattcaggagcgtgacccgcactcgctgctgaactggaat
cgacgcatgctggcggtgcgcaaacagcagaaggcattcgggcgtggcacgctgaaaatg
ctctcgccgtcgaaccgccgcattcttgcgtatacccgcgagtacacggcacccgatggt
cacagcgaagtggtgttgtgtgttgccaacgtttccagcgccgctcaggctgcagagctt
gagctgtcggcttacgcaggcacagtgccggtggaaatgctcggtggcagcgcatttccg
cctatcgggcagttaagctatttgctgacgctcccgccgtatggtttttactggttttta
ctggcttcggagaatcaaatgcccagttggcacgttgaacccgcgcagagcatgccggac
ttcccgactctggtgctcaagaagcgccttgaggagttgctcgaagagccgctgcgcagc
accatggaaaaaacgtcactggctgtttacttgccaaaacgccgctggttcgcaggcaag
ggcaaggacatagagcaggtcaatatcgcgtatgcggtgcgtttcggcgatgaggcgcac
cctgtgttgctcagcgaaatagaagtgactgcagacggccagaccgatcgctatcagctg
ccattcggcttgctcgccgaagacgacatcagcagcgcgttgccacagcaactggcactt
gccagagtgcggcgtaatcgtgatgtagggctgatcaccgatgcgtttactctggaaacc
ttcattcgtgcagtgattctgggcatgcagtcggatacggtcatcccctgcgctgacggc
gagttgcgtttcgagcaaagttcgcagctggcaccgctcgccctcaccgcagagtcggaa
gtgcgctacctgtctgccgagcagtcgaacagctcggcggtcgtcggtggcagcctagtg
ctcaaactcattcgtaaagtcagtgccgggacgcacccggagctggaaatgggtgctttc
ctgaccaacgctggcttcaagaatatctcgccgttgctgggctctgtggtgcgtgtcggc
aacgacggaaaaccgaatctgctgatgattgcccaaggctacctgagcaatcagggtgac
gcttgggagtggacacagaacaatctggaacgcgcagtacgcgatgagttggcgcatggc
gtttccggccaggaacagcattacaatgcgttgctggagctggcggacttttcgcgtagc
cttggtcagcgtctcggtgaaatgcaccagattctggcgtcgcctaccgacaattcagac
ttcgctgttgaagtcaccagcagtcaggacagcaaggcctccggaaccagcgtcaatgct
cagcttgagcgcgccttgcaactgcttgagcagcgcaagggcgatctggaacaggacgat
cagcaactggtcagcgatttgcttgcacagcgcaagcagattcgtcggcgcgtcgaaggt
ctggccaagcgctcggcaggtggcctgcggattcgcgtgcatggtgacttgcacctcggg
caagtgctggtggtcaaaggcgatgcctacctgatcgatttcgagggtgaaccggcccgc
gcacttgaagaacgccgtgccaagcacagcccgttcaaggatgtcagcggtgttttgcgc
tcgtttgactacgctgccgccatggcagtacgtagcgcacaaaacgtcgatacctcgcct
gaggctgccggtgctcgcaaacgtgtcgccgagacctacctggcgcaggcgcgggaagcc
tttatcgaaggttatcgctcggcaacgagcggaatggctcatgcctggaaagatgcaaaa
ggggaggacgccgcactggaattgttcacccttgaaaaagctgcttatgaagtgatctac
gaagccgagaatcgtccagcctggttggccgttcccttgcaaggcttgcgtgggttgctg
caaccgtctgatggagagccaatatga

DBGET integrated database retrieval system