KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_2745Help
Entry
PSPPH_2745        CDS       T00266                                 

Definition
(GenBank) dipeptide transporter dppD-like protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:psp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PSPPH_2745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psp02000]
    PSPPH_2745
Transporters [BR:psp02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    PSPPH_2745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_22 AAA_16 IstB_IS21 AAA_33 AAA_5 Mg_chelatase DUF87 Sigma54_activat AAA_29
Motif
Other DBs
NCBI-ProteinID: AAZ37518
UniProt: Q48I47
LinkDB All DBs
Position
3177306..3178154
Genome map
AA seq 282 aa AA seqDB search
MTHEQSLLNVQGLRIGFPGSGPELIEVVKGIDFTVGTEKVALVGESGSGKSLTARALLGL
VARPGQVTAEHMSLAGDDLRSLTAKQWQGLRGTRLSLVLQDPRYSLNPVLRVGTQVEEAL
VLHTRLGRRERREKVLDMLEAVGLPNPLALYDSYPHELSGGMGQRVMLAAMLINDPRLLI
ADEPTSALDSDLRDQILELILGLVEQRNMGLLLISHDLPLVAKYCDRALVMYRGRIVDRC
NAAELATASNPYTQTLWRCQPSALTYGQALATLDRKLMEALP
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgactcatgaacaatcgctgttgaacgtgcagggcttgcggatcggttttccaggctcg
ggcccggaactgatcgaggtggtcaaggggatcgatttcactgtgggcactgaaaaggtc
gcgctggtgggtgagtccggctcgggcaagtcactcaccgcgcgtgcgttgctggggctt
gtcgcacgccccggtcaggtgaccgccgaacacatgagcctggcaggcgatgacctgcgc
agccttacggcaaagcaatggcagggcctgcgcggtactcgtctgtcactggtgttgcag
gaccccaggtattcgctcaacccggtgctcagggtcggcactcaagttgaagaggcgctg
gtgttgcatacccggctgggacgccgtgagcgtcgcgaaaaagtactcgacatgctggag
gctgtaggcttgcccaacccgctggcgctgtatgacagctacccccacgaactgtccggc
ggcatggggcagcgggtgatgctcgccgcgatgctgatcaatgatccgcgccttttgatt
gccgacgaacccacctcggcactcgacagcgacctgcgcgatcagattctggagttgatt
ctgggccttgtcgaacaacgcaacatggggttactgctgatcagtcatgatctgcctctg
gtggcgaaatattgtgaccgggcgctggtcatgtaccgcgggcggattgtcgaccgatgc
aacgccgccgaactggcaactgccagtaacccctacacgcagacgctatggcgctgtcag
ccctctgctctgacctatggtcaggcacttgcgacccttgatcgcaaactaatggaggcg
ctgccatga

DBGET integrated database retrieval system