KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_3631Help
Entry
PSPPH_3631        CDS       T00266                                 

Definition
(GenBank) aminotransferase, classes I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00220  Arginine biosynthesis
psp00250  Alanine, aspartate and glutamate metabolism
psp00290  Valine, leucine and isoleucine biosynthesis
psp01100  Metabolic pathways
psp01110  Biosynthesis of secondary metabolites
psp01130  Biosynthesis of antibiotics
psp01210  2-Oxocarboxylic acid metabolism
psp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSPPH_3631
   00290 Valine, leucine and isoleucine biosynthesis
    PSPPH_3631
   00220 Arginine biosynthesis
    PSPPH_3631
Enzymes [BR:psp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PSPPH_3631
    2.6.1.66  valine---pyruvate transaminase
     PSPPH_3631
Amino acid related enzymes [BR:psp01007]
 Aminotransferase (transaminase)
  Class I
   PSPPH_3631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Costars
Motif
Other DBs
NCBI-ProteinID: AAZ33743
UniProt: Q48FR1
LinkDB All DBs
Position
4174987..4176198
Genome map
AA seq 403 aa AA seqDB search
MQFNKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVGIEDIYLGNGVSELIVMSMQALLNNGDE
VLVPAPDYPLWTAAVALSGGSPVHYLCDEQANWWPDLEDIKAKITPNTKAMVIINPNNPT
GAVYSREVLLGMLELARQHNLVVFSDEIYDKILYDDAMHICTASLAPDLLCLTFNGLSKS
YRVAGFRSGWIAISGPKHNAQSYIEGIDILANMRLCANVPSQHAIQTALGGYQSINDLIL
PPGRLLEQRNRTWELLNDIPGVSCVKPMGALYAFPRIDPKVCPIFNDEKFVLDLLLSEKL
LVVQGTAFNWPYPDHFRVVTLPRVDELEQAIGRIGNFLKGYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcaacaaatcgaacaagctcgcaaacgtctgctacgacattcgcgggccggtg
ctcaagcacgccaaacgcctggaagaggaaggccatcgcatcctcaagctgaacatcggc
aacccggcaccgtttggcttcgaggcgccggacgaaatcctgcaggacgtgatccgcaac
ttgccgactgcgcagggctacagcgactccaagggcctgttcagcgcccgcaaggcggtg
atgcagtattaccagcagaagcaggtcgaaggcgtcggcatcgaagacatctacttgggc
aacggcgtgtccgagctgatcgtgatgtcgatgcaggcgctgctcaacaatggcgacgaa
gtgctggttccggcccccgactatccgctgtggaccgctgctgtcgccttgtccggtggc
agcccggtgcattatctgtgcgacgagcaggccaactggtggccagaccttgaagacatc
aaggccaaaatcacgcctaacaccaaggccatggtgatcatcaaccccaataacccgacc
ggcgcagtgtattcccgcgaggtattgctgggcatgctggagctggctcgccagcataat
ctggtggtgttctccgacgaaatctacgacaagattctctatgacgacgcaatgcacatc
tgcaccgcctcgctggcaccggacctgctgtgcctgaccttcaacggtctgtccaagtcg
tatcgggttgcgggcttccgttccggctggatcgccatttccgggccgaaacacaacgcg
cagagctacatcgaaggcatcgacattctggccaacatgcgcctgtgtgccaacgtaccg
agccagcacgccattcagactgcactgggcggctatcagagtatcaacgacttgattctt
cctcctggccgcctgctggaacagcgcaaccgcacctgggaactgctcaacgatattccc
ggcgtcagctgcgtcaagccgatgggcgcgctgtatgcattcccgcgcatcgacccgaag
gtgtgcccgatcttcaacgacgaaaaattcgtcctcgacctgctgctttctgaaaaactg
ctggtagttcagggcaccgcgttcaactggccataccctgatcacttccgcgtcgtgaca
ctgccacgtgtcgacgaactggagcaggccattggccgcatcggtaacttcctgaagggt
tatcgtcagtaa

DBGET integrated database retrieval system