KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_4064Help
Entry
PSPPH_4064        CDS       T00266                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Brite
Enzymes [BR:psp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PSPPH_4064 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AAZ35309
UniProt: Q48EJ8
LinkDB All DBs
Position
4645239..4645820
Genome map
AA seq 193 aa AA seqDB search
MAFELPPLPYAKDALVPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIIKTS
SGGIFNNAAQVWNHTFYWECLAPNAGGEPTGALAEAINTAFGSFDKFKEEFSKTSIGTFG
SGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWDFVAKQFEA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattgccgccactgccctacgccaaagacgctctggtgccgcacatttct
gcggagactctggaatatcaccacgacaagcaccacaacacctacgtcgtgaacctgaac
aacctggtgccaggcaccgagttcgaaggcaagaccctggaagaaatcatcaagacctct
tcgggcggtatcttcaacaacgccgctcaggtctggaaccacacgttctactgggaatgc
ctggcccctaacgctggcggcgaacctaccggcgcgctggccgaggcgatcaacactgca
ttcggttccttcgacaagttcaaggaagagttcagcaaaacctccatcggcacattcggc
tccggctggggctggctggtgaagaaggctgacggctctctggctctggccagcaccatc
ggtgccggcaacccgctgaccagcggcgacaccccgctgctgacctgcgatgtgtgggaa
cacgcctactacatcgactaccgcaatctgcgtcctaagtacgtagaagcgttctggaac
ctggtgaactgggacttcgtggccaagcaattcgaagcctga

DBGET integrated database retrieval system