KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_4444Help
Entry
PSPPH_4444        CDS       T00266                                 

Gene name
accC2
Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00061  Fatty acid biosynthesis
psp00620  Pyruvate metabolism
psp00640  Propanoate metabolism
psp01100  Metabolic pathways
psp01110  Biosynthesis of secondary metabolites
psp01120  Microbial metabolism in diverse environments
psp01130  Biosynthesis of antibiotics
psp01200  Carbon metabolism
psp01212  Fatty acid metabolism
Module
psp_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:psp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSPPH_4444 (accC2)
   00640 Propanoate metabolism
    PSPPH_4444 (accC2)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PSPPH_4444 (accC2)
Enzymes [BR:psp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PSPPH_4444 (accC2)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PSPPH_4444 (accC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 LAL_C2 ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AAZ36165
UniProt: Q48DI1
LinkDB All DBs
Position
5075886..5077229
Genome map
AA seq 447 aa AA seqDB search
MLEKVLIANRGEIALRILRACKELGIKTVAVHSTADRELMHLGLADETVCIGPAPANLSY
LNIPAIISAAEVTGATAIHPGYGFLAENADFAEQVEKSGFAFIGPKADTIRLMGDKVSAK
DAMKLANVPTVPGSDGPLPEDEATALRIGREVGYPVIIKAAGGGGGRGMRVVHREEDLIE
AASQTRAEAAAWFSNPMVYLEKYLTNPRHVEVQVISDGQGQAIHLGDRDCSLQRRHQKVL
EEAPAPFIDEQARADVLAACVKACIDIGYRGAGTFEFLYENGRFYFIEMNTRVQVEHPVS
EMVTGIDIVKEMLSIAAGNKLSYTQDDVVIKGHALECRINAEDPKTFVPSPGLVKHFHAP
GGNGVRVDSHLYSGYKVPSNYDSLIGKVITWGATREEAMARMRNALDEIVVDGIKTNIPL
HRDLTRDEGFCEGGVNIHYLEHKLANQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaaaagttctaatcgccaaccgcggcgaaattgccttgcgcatcttgcgtgcc
tgtaaagaactgggcatcaagaccgtcgctgtacactccacggcagatcgcgagttgatg
cacctgggcctggcagacgaaaccgtctgcattggtccggcaccagccaatctgtcctac
ctgaacattccggcgatcatctcggctgccgaagtgaccggtgccacggcgatccaccct
ggctacggcttcctcgctgaaaacgccgatttcgccgaacaggtcgaaaaatcgggtttt
gccttcatcggcccgaaagcagacaccatccgcctgatgggcgacaaggtttctgccaag
gacgccatgaagctggccaacgtgccaaccgttccgggctccgacggcccgctgccggaa
gacgaagcaaccgctctgcgcattggtcgtgaagtgggttacccggtgatcatcaaggcc
gccggtggcggtggtggtcgcggcatgcgtgtggttcatcgcgaagaagacctgatcgaa
gccgcctcccagacccgcgccgaagctgcggcctggttcagcaacccgatggtctacctg
gaaaaatacctgactaacccgcgtcacgtggaagtccaggtcatttccgacggccagggc
caggcgattcatctgggcgaccgcgactgctcgctgcagcgccgacaccagaaggttctg
gaagaagcaccggcaccgttcatcgacgaacaggcgcgtgcggatgttctggctgcctgc
gtcaaggcgtgtatcgatatcggctatcgcggcgcgggtactttcgagttcctgtacgag
aacggtcgtttctacttcatcgaaatgaacacccgtgttcaggtggagcacccggtatcc
gaaatggtcaccggtatcgacatcgtcaaggagatgctcagcatcgccgccggcaacaaa
ctgtcgtacacccaggatgacgtggtcatcaaagggcatgcgctggaatgccggatcaac
gccgaagacccgaaaaccttcgttccaagcccaggtctggtcaagcacttccacgcaccg
ggcggcaacggtgtgcgggtcgattcgcacctgtacagcggctacaaggttccgtccaac
tacgactcgctgatcggcaaagtgatcacctggggcgcgacccgcgaagaagccatggca
cgcatgcgcaatgccctggacgaaatcgtggtcgacgggatcaagaccaatatcccgctg
caccgtgatctgacccgtgatgaaggcttctgcgaaggcggagtcaacatccactacctg
gagcacaaactggccaatcaataa

DBGET integrated database retrieval system