KEGG   Psychrobacter sp. P2G3: AK823_02865Help
Entry
AK823_02865       CDS       T04386                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pspg  Psychrobacter sp. P2G3
Pathway
pspg00970  Aminoacyl-tRNA biosynthesis
pspg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pspg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AK823_02865
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pspg03029]
    AK823_02865
Enzymes [BR:pspg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AK823_02865
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AK823_02865
Mitochondrial biogenesis [BR:pspg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AK823_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AMN48961
LinkDB All DBs
Position
complement(683398..684894)
Genome map
AA seq 498 aa AA seqDB search
MSELHLLSTQQLIMGLQDKQFSSLELTEHYIKRIDALDSKINSFITHTSETARAQAQAAD
EMRAQGDKRRLLGVPMAHKDIFCTQGVLTTCGSKMLHNFVSPYNATIVSNIDKAGMISLG
KLNMDEFAMGSDNSSSYYGTVQNPWDLERVPGGSSGGSAAAVAAGFIPVATGSDTGGSIR
QPASFCGLTGIKPTYGRVSRFGMIAYASSLDQAGSMGRSAKDCAYLLQPMIGHDPRDATS
IKHDMPDYVQDLNDAEAAAGDKPFDGLRIGVAKEYFSKGLDAEVEQSVRAALKKYEELGA
TIVEVNITDPDITLATYYMLAPAEASSNLSRFDGVRFGYRCENPTDLIDLYTRSRSEGFG
PEVQRRILTGTYALSAGYFDAYYTKAQKIRRLIVKDFEDAFANCDVIASPTAPTAAYKLA
EDLDPATMYLGDVYTIAVNLAGLPALSQPVGLTSEGLPVGLQLIGQYWQESKLLATAHLF
QQHTDHHLQHSTIAKETV
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacttcatctattaagtacccagcaactcattatgggcttgcaagacaaacaa
tttagcagccttgagctgaccgaacattacatcaagcgcatagacgcgctagatagcaag
attaacagctttattactcatacctcggagactgcccgagcgcaagcgcaagcagcagac
gagatgcgtgcacaaggtgataaaagacgcttattgggcgtgcctatggcgcataaagat
atcttttgtacccaaggcgtattaacgacttgtggctcaaaaatgctacataacttcgtc
tcaccttataacgccactattgtctctaacattgataaagcgggcatgattagccttggt
aagctcaatatggatgagtttgcgatgggctcagacaacagcagctcttattacggtacc
gtacaaaacccttgggatctagaacgcgttccaggtggctcttctggtggtagtgccgca
gcggtcgccgcaggttttatcccagtcgcaaccggtagtgatacgggtggctctattcgt
cagcctgcttcattttgcggcttaacaggcatcaaacctacttatggccgcgtatcacgt
tttggtatgattgcctacgcttcaagtcttgatcaagctggtagcatgggtcgtagcgct
aaagattgtgcctatctattacaaccaatgattggtcacgatccacgcgatgcaacctct
atcaaacatgatatgccggactacgtgcaagaccttaatgatgcagaagctgctgctggc
gataagccatttgatggtttacgtattggtgtcgctaaagaatattttagtaaagggctt
gatgctgaagtagaacaatcggtacgtgctgctctgaagaagtatgaagaactaggcgcg
acaatcgtagaagtgaacatcactgaccctgatatcacgcttgcgacttactatatgtta
gcacctgcagaagcgtcttcgaacctgtcgcgcttcgatggcgtgcgttttggttatcgc
tgtgaaaacccaaccgatcttattgatttatacacgcgctcacgctctgaaggctttggt
cctgaagtacagcgccgtatcttgacaggtacgtatgcgctgtctgctggttattttgac
gcttattatactaaagcacaaaaaatacgccgcttaatcgtcaaagacttcgaagacgct
tttgccaactgtgatgtcattgccagtccaactgcaccaacggctgcttacaagcttgct
gaagatcttgaccctgcaaccatgtatttgggcgatgtttatacaatcgcggttaactta
gccggtctacctgcgctcagccagccagttggtctgacctcagaaggcttacctgttggc
ttgcaactaattggtcaatattggcaagaaagtaagctgctagccaccgcgcatctgttc
cagcagcatacagatcaccatttgcaacactctaccatcgcgaaggagacggtataa

DBGET integrated database retrieval system