KEGG   Psychrobacter sp. P2G3: AK823_09335Help
Entry
AK823_09335       CDS       T04386                                 

Definition
(GenBank) 4-carboxymuconolactone decarboxylase
  KO
K01607  4-carboxymuconolactone decarboxylase [EC:4.1.1.44]
Organism
pspg  Psychrobacter sp. P2G3
Pathway
pspg00362  Benzoate degradation
pspg01100  Metabolic pathways
pspg01120  Microbial metabolism in diverse environments
pspg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pspg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AK823_09335
Enzymes [BR:pspg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.44  4-carboxymuconolactone decarboxylase
     AK823_09335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMD
Motif
Other DBs
NCBI-ProteinID: AMN50965
LinkDB All DBs
Position
2316391..2316816
Genome map
AA seq 141 aa AA seqDB search
MENHDIENKDIEHNANYQNGLKVRTEVMGEAHVKRSLDSATGFTQPLQDWIIENAWGSTW
QDDSVLPRKYRSLITIAFLIAQKSPTELKGHIRGAINNGASVAEIREVLMHSLPYCGAPA
TQEAFRAAIEILNELDIDIDI
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccacgacatagaaaacaaggatatagagcacaacgctaattatcaaaacggt
ctcaaggttcgtactgaagtaatgggcgaggcacatgtcaaacgctcgcttgatagcgca
actggatttacccagccattgcaagactggatcattgaaaacgcttggggcagcacttgg
caagatgactcggtattaccgcgcaaatatcgctcattaatcaccatcgcctttttaatt
gcgcaaaagagcccaactgagctaaaaggacacattcgaggtgccattaataacggtgcc
agtgtcgctgagattcgagaagtattgatgcacagtttgccttactgcggtgcacctgcc
acccaagaagcgtttcgtgctgctatagaaatactgaatgaattggacattgacatagat
atttaa

DBGET integrated database retrieval system