KEGG   Psychrobacter sp. P2G3: AK823_11450Help
Entry
AK823_11450       CDS       T04386                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pspg  Psychrobacter sp. P2G3
Brite
KEGG Orthology (KO) [BR:pspg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AK823_11450
Enzymes [BR:pspg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AK823_11450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like Thioredoxin_3 FAD_binding_2 NAD_binding_8 Thi4 DAO K_oxygenase FAD_oxidored AlaDh_PNT_C NAD_binding_7 Lycopene_cycl FAD_binding_3 Shikimate_DH Glutaredoxin 3HCDH_N Thioredoxin_4 NAD_binding_9 DSBA T4BSS_DotH_IcmK
Motif
Other DBs
NCBI-ProteinID: AMN50408
LinkDB All DBs
Position
complement(2797241..2798818)
Genome map
AA seq 525 aa AA seqDB search
MIDQSLLDAVKSYSENMTRPITFVLGSGEHQKRAELIDFLTKIAGTTDKINFDATANDDS
LPSPISFAVRSHIGGTLTDTGIVFSGIPGGHEFTSLILAILQAGGHTLKLDEGIQKLIKR
FNKPLQFQTYVSLSCHSCPEVVQALNQFALLNDDISNEMIDGALFQEQVEANNIQGVPAV
FLNGKPFANGLIDTAKLIEKLQEQFPDLLAEADDDAEQLEQQDVTIIGAGPAGIAAAIYT
ARKGLKVTMVADRIGGQVKDTQDIENLISVPLTTGNELSANFEKHLQEYNITLKEHVSVK
EISETEEENYSIHLNTGEKFETRSIILATGAQWRKLGVPGEEENIGKGVAYCAHCDGPFF
KDKDISVIGGGNSGVEAALDLAGIVKHVTVLEFADDLKADQVLINKAKEKANIEFITGAA
TQEIKATDGKVTSIVYQDRSTGETHERDLAGVFVQIGLVPNTGFIKGFVDLNRFGEIEID
ERCRTDRKGIFACGDVTTVPFKQINIAMGEGSKAALSAFEYLVMQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgatagatcaaagtttattagacgctgttaagagctatagcgaaaatatgactcgtcca
attactttcgtattgggtagtggtgagcatcaaaaacgtgcagagctaattgattttttg
accaaaattgctggcactaccgataagattaattttgatgcaacagcgaatgatgatagc
ttaccaagtccgattagctttgcggtccgtagtcatattggtggcacgttgactgatact
ggtatcgtctttagtggtatcccaggcggtcatgaatttacctcgcttatcttggcaatc
ttacaagctggtggtcatacgctaaaactagatgagggtatccaaaagctcatcaagcgt
ttcaataagccattacagtttcaaacatacgtgtcgctctcttgccacagttgcccagaa
gtcgttcaagcgttgaaccagtttgcgctactaaatgatgatatcagcaatgaaatgatc
gatggtgcattgttccaagagcaagtagaagcaaataacatccaaggcgtaccggcagta
tttttaaacggtaaaccgtttgctaatggtctgattgataccgccaagctcattgaaaag
ctacaagagcaattccctgatttattagcagaagcggacgatgatgccgagcagttagag
cagcaagatgtcactatcatcggtgctggtcctgctgggattgccgccgcgatttatacc
gcgcgtaaaggcttaaaagtgacgatggtcgcagatcgtatcggtggacaggtgaaagat
acacaagatatcgaaaacttaatctctgtgccattgaccacaggcaatgaattgtctgcc
aattttgaaaagcacttgcaagagtacaatatcacgctcaaagagcacgtgagtgtcaaa
gaaattagcgagacggaagaagaaaattacagcattcatctaaacacgggtgagaagttt
gagactcgcagtattatcttagcgactggtgcgcaatggcgtaaacttggtgtaccaggt
gaagaggaaaatatcggtaaaggcgttgcctactgtgcgcactgtgacggtcctttcttt
aaagataaagacatctcagttatcggtggcggtaactctggtgtcgaagcagcattagac
cttgcaggtatcgtgaagcatgtgaccgtacttgaattcgcagatgatttaaaagcggat
caggtattgattaacaaagccaaagaaaaagccaatattgaatttatcactggggcggcg
acgcaagagattaaagcgactgatggtaaagtgacttctattgtttatcaagatcgcagc
acaggtgagacccatgagcgtgacttggcaggagtgttcgtacagattggcttagtgcca
aatactggattcattaaaggctttgtcgatttaaaccgttttggtgagattgagattgat
gagcgttgccgtaccgatcgcaaaggtatctttgcttgtggtgacgtaacgacggtaccc
tttaaacagattaacattgcgatgggtgagggttctaaagctgctctaagtgcttttgaa
tacttagttatgcagtaa

DBGET integrated database retrieval system