KEGG   Psychrobacter sp. P2G3: AK823_12235Help
Entry
AK823_12235       CDS       T04386                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pspg  Psychrobacter sp. P2G3
Brite
Enzymes [BR:pspg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AK823_12235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMN50542
LinkDB All DBs
Position
complement(2993785..2994414)
Genome map
AA seq 209 aa AA seqDB search
MSKITLPDLPYAKDALEPHISAETLEYHHDKHHAAYVNKLNDLLPGSGLEDKTLPEIIEA
TSKDDSKQGMFNQAAQVWNHTFYWNCMTPDNGGGEPTGDLKAKIEEDFGSYDKFREEFKN
AALTQFGSGWAWLVADKEGGKLSIAKTANADTPLAHGQVAVLTCDVWEHAYYIDYRNRRP
DYVDTFLDKLVNWDYANAKYKGQDAGVEE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagattactttaccagacctaccttatgcaaaagacgcacttgagccgcatatc
agcgctgagacgttagaatatcatcatgataagcatcatgctgcctatgtaaacaagtta
aacgatttgctaccaggttctggtctagaagacaaaacattgccagaaatcatcgaagcg
acgtcaaaagatgacagcaagcaaggtatgtttaaccaagcagcgcaagtatggaaccac
acgttctattggaactgcatgacgccagacaatggcggcggcgaacctactggcgatcta
aaagccaaaatcgaagaagattttggtagctatgataagttccgtgaagagtttaaaaat
gcagcgttaacgcagttcggttctggttgggcatggttagttgctgataaagaaggcggc
aaactgtctatcgctaaaactgctaatgctgatacgccactggcacatggtcaagtagcg
gtattgacttgtgatgtgtgggaacatgcgtattacattgattatcgtaaccgtcgtcct
gactatgttgacacgttcctagataagctagtgaactgggactacgcaaacgctaaatat
aaaggtcaagatgctggcgttgaagagtaa

DBGET integrated database retrieval system