KEGG   Pseudohongiella spirulinae: PS2015_1026Help
Entry
PS2015_1026       CDS       T04158                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pspi  Pseudohongiella spirulinae
Pathway
pspi00250  Alanine, aspartate and glutamate metabolism
pspi00410  beta-Alanine metabolism
pspi00430  Taurine and hypotaurine metabolism
pspi00650  Butanoate metabolism
pspi01100  Metabolic pathways
pspi01110  Biosynthesis of secondary metabolites
pspi01120  Microbial metabolism in diverse environments
pspi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pspi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PS2015_1026
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PS2015_1026
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PS2015_1026
   00430 Taurine and hypotaurine metabolism
    PS2015_1026
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PS2015_1026
Enzymes [BR:pspi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PS2015_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 Aminotran_1_2 SepSecS HTH_8 HTH_19 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: ALO45691
UniProt: A0A0S2KBH9
LinkDB All DBs
Position
complement(1101813..1103456)
Genome map
AA seq 547 aa AA seqDB search
MSESKKLASASLESLYRIFTVPEAPDSTLGRIDQSISQNLAGFLQEHIVASERDLSDIEK
DFADPQIPEQPTFVSDQIQFVLDKLVAQSVHISAPSFVGHMASALPYFMLPLSRIMMALN
QNLVKVETSKAFTPMERQVVGMIHHLVYGRDKDFYTQWMHDRAHALGSFCSGGTIANLTA
LWAARNNVLAPTEGFAGLGQEGLVAGMQHYGYKGLAILVSERGHYSLGKAADILGIGRRS
LIAIETDANNKIRTDLLAKKCDELAAANIKVMAIVGIAGASETGSIDPLDQMADIAQERG
IHFHVDSAWGGPTLFSNTYRPLLKGIERADSVTLDAHKQLYVPMGAGICVFKEPSTLSSV
EHHAEYIIRKGSKDLGSHTVEGSRPGMAILVHSGLHIIGRQGYELLIDQGISRARHFADM
IRADKDFELISEPELNILTYRYVPQDIQTALESAPASLRTEVNEQLNLVTKRIQKTQRGL
GRSFVSRTRLNPHHHNRNAVIVFRAVLANPLTTNQILQDMLAEQKEIAATPPIQALLKQV
RNLFCGC
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaagtaaaaaactggccagcgccagcctcgagtctttgtaccggattttcact
gtaccggaggcaccggattcaacgctggggcgaatcgatcaatcaatatcacagaatctt
gccggttttctgcaggaacatattgtcgcctcagagcgcgatctttcagatatcgaaaag
gatttcgccgacccacagatcccggaacagccgaccttcgtttctgatcagatccagttt
gtactggataaactggtcgctcaatctgtacacatttcggcaccgagttttgtcggtcat
atggcctcggcgctaccctatttcatgctgccgctctcgcgcatcatgatggctctgaac
cagaacctggtaaaggttgaaacttccaaagcctttacaccgatggagcgccaggtcgtc
ggcatgatccatcatctggtatacggccgggacaaggatttttacacccaatggatgcac
gacagggcccatgcactgggcagcttctgctctggtggtacaatcgccaatctgacggcg
ctgtgggcggcacgcaataacgtattggcgccaactgaaggcttcgctggactggggcag
gaaggcctggtggccggcatgcagcactacggatacaaagggctggccattctggtctca
gaacgcggccactattcgctgggtaaggccgccgatattctgggcataggccgccgttcg
ttgatcgctatcgaaaccgacgccaacaataaaatccgcactgacctgctggccaaaaaa
tgtgatgaactggctgcggccaatatcaaagtaatggccattgtcggcattgccggtgca
tctgaaaccggcagcatagatccgctggaccagatggccgatatcgctcaggagcgcggc
atacactttcacgtcgactcagcctggggcggacccacgctgttctcgaatacctaccgc
cccctgctgaagggcattgaaagagccgattcagtcactctggatgcccataagcagcta
tatgtacccatgggtgccggcatttgtgtattcaaggagcccagcacgctgagtagcgtc
gagcatcatgcggagtacataatacgcaaaggctccaaagatctgggcagccatacagtc
gaaggttcacggccgggcatggcgatcctggtgcactcgggattgcatattatcggacgc
cagggttatgaactgcttattgatcagggcatcagtcgcgccagacattttgccgatatg
attcgggccgacaaggattttgaactgatcagcgagcccgaattgaatattctgacctat
cgttatgtaccgcaggatattcagacggctctggaatcggcaccggccagcctgcgcacc
gaggtcaacgaacagctgaacctggtcaccaaacgcattcagaaaactcagcgcgggctt
ggacgatcattcgtttcacgaacccggcttaatccccatcatcacaacaggaatgcggtc
atcgtcttccgggctgtactggccaacccgctgacgaccaatcagattcttcaggacatg
ctggcggagcaaaaagagatcgcagctaccccgccgatacaggcactgctgaagcaggtt
cgcaacctgttctgcggctgctga

DBGET integrated database retrieval system