KEGG   Pseudohongiella spirulinae: PS2015_1117Help
Entry
PS2015_1117       CDS       T04158                                 

Definition
(GenBank) Glutathione S-transferase, C-terminal domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pspi  Pseudohongiella spirulinae
Pathway
pspi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pspi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PS2015_1117
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pspi02000]
    PS2015_1117
Enzymes [BR:pspi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PS2015_1117
Transporters [BR:pspi02000]
 Other Transporters
  Pores ion channels [TC:1]
   PS2015_1117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: ALO45779
UniProt: A0A0S2KCF1
LinkDB All DBs
Position
1225545..1226144
Genome map
AA seq 199 aa AA seqDB search
MKIYGDHQSGNCYKIALVCALLEIEHEWIPVDILAGQTRTAEFLQRNPNGKIPLLELDDG
RTLSESNAIINYLAAGTSLLPADRFDQAKVQQWQFFEQYSHEPYIAVARFIAKYLGLPEA
RRAEYEAKQDGGYKALAVMERQLQQSSFLAGNMLTTADVSLYAYTHVADEGGFELNDYPA
VQTWIARIKQQPGYVSMPG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatacggggaccatcaatcaggcaattgttacaagatagctcttgtctgtgct
cttctggagattgagcacgagtggatccctgttgatattcttgcaggccagacgcgcacg
gccgaatttctgcagcgcaatcccaatggcaagattcccctgcttgagttggatgacggt
cgcactctgtcagagtccaatgccatcatcaattacctggctgcaggcacttcgctgctt
ccggccgaccgttttgatcaggccaaagttcagcagtggcagtttttcgaacaatacagc
catgagccttacattgcggtggcacgttttatcgctaaatatctgggattgcccgaggcg
cggcgggctgaatacgaagccaaacaggatggcggatacaaggccctggctgtgatggag
cgacagttgcagcagtcgtcttttctggcggggaatatgctcacgacggctgatgtgagc
ctgtacgcctatacgcacgtagcggatgaaggtgggtttgagttgaatgattatccggca
gtacagacatggattgcgcgtatcaaacaacagcccgggtatgtaagcatgccgggctaa

DBGET integrated database retrieval system