KEGG   Pseudohongiella spirulinae: PS2015_136Help
Entry
PS2015_136        CDS       T04158                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pspi  Pseudohongiella spirulinae
Brite
KEGG Orthology (KO) [BR:pspi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PS2015_136
Enzymes [BR:pspi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PS2015_136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 AlaDh_PNT_C HI0933_like FAD_oxidored Thi4 NAD_binding_8 NAD_binding_7 Glutaredoxin K_oxygenase DAO FAD_binding_3 FMO-like Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: ALO44831
UniProt: A0A0S2KA39
LinkDB All DBs
Position
complement(151658..153211)
Genome map
AA seq 517 aa AA seqDB search
MLDANMKTQLKAYLEKVSRPFELVASLDDGAKSQELRSLLQDIAALSDKITVREDGQDDR
RPSFELVRPDAEMHLRFAGIPMGHEFTSLILALLQTGGHPPKLSEETIAQIKAIEGEFHF
ETYFSLSCQNCPDVVQALNVMAVLNPNIRHVAIDGALFQNEVETRQIMSVPSVYLNGEPF
AQGRMSVDEILAKIDTGAEEREAARLNDKEAFDVLMIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVKETEGPQLARQLEEHVRQYDVDIMNMQRASALIPAVEPGG
LHEVQFASGASLKARTVIISTGARWRELNVPGENTYRNKGVAYCPHCDGPLFKGKRVAVV
GGGNSGVEAAIDLAGLVAHVTVLEFADTLKADEVLQRKLRSLPNVDVICSAQTTEVLGDG
QKVNGLQYKDRRTDEMHTVELEGVFVQIGLLPNSEWVKGTVKTTQFGEIEIDNKGQTNIP
GVFAAGDVTNIPYKQIVIAMGEGSRSALSAFDYLIRQ
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgcaaatatgaaaacccagctcaaggcctatctggagaaagtcagccggcct
tttgaattggtagcgtcgctggacgacggtgccaagtctcaggagctgcgttcactgctg
caggatattgctgcgctgagtgacaaaattactgtccgcgaagacgggcaggatgatcgt
cgcccgtcctttgagctggtcagacccgatgctgagatgcacctgcgttttgccggcatt
ccaatgggacacgaatttacctccctgattctggccttgctgcagaccggcggacacccg
cccaagctgagcgaagaaacgattgcccagatcaaggctattgagggcgaatttcacttt
gaaacgtatttttcgctgtcctgccagaactgcccggacgtggtgcaggcgttaaacgtc
atggctgtgctgaatcccaacatccgccatgttgccattgacggtgcgctgtttcagaac
gaggtggaaacccgacagatcatgtcggtacccagcgtctatctaaatggtgagcctttc
gcccagggacgcatgagtgtcgatgaaattctggcgaaaattgacacaggcgctgaagag
cgtgaagcagcccgactgaatgataaagaagccttcgatgtcctgatgatcggcggtggc
cctgccggcgcagcggcagccatttacgcggccagaaaaggcattcgcactggtgtggcg
gctgagcgcttcggcggtcaggtgctggataccatggccatcgagaattttatttcagtg
aaggaaaccgaaggcccgcagctcgcccgccagctcgaggagcatgtgcgccagtacgat
gtagacatcatgaacatgcaacgcgcctcggcactgattcccgccgttgaacccggcggg
ctgcacgaagtgcagtttgccagcggcgcctctctcaaggcacgcacggtgattatcagc
accggcgcccgttggcgcgaactgaatgtacccggcgagaatacctatcgcaacaagggc
gttgcctactgcccgcactgtgacggtccgctgttcaagggtaaacgcgttgcggtggtc
ggcggtggcaactcaggcgtagaggccgccatcgatctcgccgggctggtggcacatgtc
actgtactggagttcgcagatacactaaaagccgacgaagttctgcaacgcaagctgcgc
agcctgccgaatgtcgatgttatctgctcagcccagacaactgaggtattgggtgacggc
cagaaagttaatggcctgcagtacaaagaccgacggactgacgagatgcacaccgttgaa
ctggaaggtgtctttgtgcagatcggcctgctgcccaatagcgaatgggtaaaaggcact
gtgaaaaccacacagttcggcgaaatcgaaatcgacaacaagggccagaccaacatccct
ggtgtttttgcggccggcgatgtaacaaacatcccttacaagcagattgtcattgccatg
ggcgagggctcccgctccgcactcagcgcctttgactatctgatacgtcagtaa

DBGET integrated database retrieval system