KEGG   Pseudohongiella spirulinae: PS2015_2172Help
Entry
PS2015_2172       CDS       T04158                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
pspi  Pseudohongiella spirulinae
Pathway
pspi00550  Peptidoglycan biosynthesis
pspi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pspi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PS2015_2172
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pspi01002]
    PS2015_2172
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pspi01011]
    PS2015_2172
Enzymes [BR:pspi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PS2015_2172
Peptidases and inhibitors [BR:pspi01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   PS2015_2172
Peptidoglycan biosynthesis and degradation proteins [BR:pspi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   PS2015_2172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ALO46808
UniProt: A0A0S2KEQ8
LinkDB All DBs
Position
complement(2368133..2369338)
Genome map
AA seq 401 aa AA seqDB search
MTIVGNNGQSAIISGWRRLTAWVTLAGVLMLSIVPASAQTIMPRPPEIAGSSYILMDATT
GYVIMEHNADEALPPASLTKMMTSYVAEVEIDNGNMTYEDQVFISEKAWRTQGSKTFVDV
NSYVRVDDLLRGIIIQSGNDASVAMAEHIAGSEEAFADLMNQHAQVLGMTNSYFINSSGL
DDDGNTNLMSARDLATLARVKIMEHPRHYAMYSEREFTFNGITQANRNTLLFRDPSVDGM
KTGWTTQAGYCLVASAERDNMRLISVVMGTASEDARAVETQKMLSYGFRFYETRKLYDAG
EVLDSARVWSGAENSVDLGIRDEVVLTVPRGRSDDLVVTLDTEEIIRGGFDAGTVLGQVQ
ITLDEDVLYSGDVIATQAVERAGFIKRIIDALTLFFMGLFS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagttggaaataacgggcagtcggcaataatcagcggctggcgcaggttgaca
gcctgggtgacactggcaggtgttttgatgctgagtatcgtgcccgccagtgcgcagaca
atcatgccgcggccacctgaaattgctggcagcagttacattctgatggatgccacaacc
ggctacgtgatcatggagcacaatgctgacgaggcgttaccaccggcaagtctgaccaaa
atgatgacctcctatgttgccgaagttgaaatagacaatggcaacatgacctacgaagat
caggtatttatcagtgaaaaggcctggcgtacccagggctccaagacgtttgtggacgta
aacagctatgtcagagttgacgacctgcttcgcggcatcattattcagtccggcaacgac
gccagtgttgccatggctgaacatatagcaggcagcgaggaagcatttgctgatctcatg
aatcagcacgctcaggtactgggaatgactaattcctattttatcaactcaagcggcctg
gatgacgatggcaacaccaacctgatgtcggcacgtgatctggcaacgctggcgcgggtc
aagatcatggagcatccgcgtcactacgcgatgtactctgagcgggaatttacatttaac
ggcattactcaggccaatcgaaatacactgctgttccgtgacccctcagtggacggcatg
aaaaccggttggaccactcaggcaggttactgtctggtggcttcggccgagcgcgataat
atgcgcctcatttctgtggtcatggggacagccagtgaggatgcacgtgccgttgagact
cagaaaatgctgagctatggtttccgcttctatgagactcgcaagctttacgatgccggt
gaagtgcttgacagcgcccgggtctggtcgggcgcggaaaattctgttgatctcggtatt
cgcgatgaagtcgtcttgacagtacctcggggccgctcggacgatctggtggtcactctg
gatacagaagagatcattcgcgggggattcgatgccgggactgtgctggggcaagtgcag
atcacattggatgaggatgtgctttacagtggtgatgtgattgccacgcaggctgttgaa
cgggccggattcatcaagcgcattatcgatgccctgaccctgttctttatgggattgttc
agctaa

DBGET integrated database retrieval system