KEGG   Pseudohongiella spirulinae: PS2015_767Help
Entry
PS2015_767        CDS       T04158                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pspi  Pseudohongiella spirulinae
Pathway
pspi00970  Aminoacyl-tRNA biosynthesis
pspi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pspi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PS2015_767
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pspi03029]
    PS2015_767
Enzymes [BR:pspi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PS2015_767
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PS2015_767
Mitochondrial biogenesis [BR:pspi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PS2015_767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ALO45444
UniProt: A0A0S2KBG1
LinkDB All DBs
Position
complement(799133..800581)
Genome map
AA seq 482 aa AA seqDB search
MLSKTAAELSQALSRKELSSVELTQAFLDRIATLNPTLNAYITVAAEQALAQAAQADDML
AAGTGGPLTGIPMAHKDIFCTRGVLTTCGSRMLHNFVSPYDATVVERLQSAGVVMLGKTN
MDEFAMGSSNETSYYGAVRNPWDTQRVPGGSSGGSAAAVAADLCVMATGTDTGGSIRQPA
SFCGITGLKPTYGRVSRFGMIAFASSLDQAGPLSKSAEDAALMMNAMAGTDLRDSTSLDH
PVEDFTALLQNSLSGLRIGLPKQHFTADLNPAVQQILQDAIKVLEGLGASVSEVDLPHNH
LSVPAYYVVAPAEASANLSRFDGVRFGYRCENPLNLEDLYKRSRGEGFGDEVKRRIMVGT
YALSAGYYDAYYKKAQKIRRLIKQDFDDAFRDVDVILGPTSPHTAFKLGEKNSDPVTMYL
EDIYTIAVNLAGIPGMSLPAGMLNGLPIGMQLVGPAFSEARLLNVAHQFQLNTNWHTMRP
EV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtaaaaccgctgccgaactgtcgcaggcactgagccgcaaagagctgtccagt
gttgaattgacacaggcatttctggatcgcattgccacgctgaatccgaccttaaacgcc
tacattacagttgccgctgagcaggcactggcccaggctgcgcaggcagatgacatgctg
gccgcgggcacgggcggccccctgacgggcattccgatggctcacaaagacatcttctgt
acaagaggtgtattaaccacctgcggctcgcgcatgctgcataactttgtatcgccctac
gatgccacagtcgttgagcgcctgcagagcgcgggtgtggttatgctcggcaaaaccaat
atggatgagttcgccatgggctcttccaacgagaccagctactacggcgcggtccgcaac
ccctgggacacccagcgcgttccaggcggttcatcaggtggctcagcagcggccgtcgca
gccgatttgtgtgtcatggccacgggcactgataccggcggctcgattcgccagcccgca
tcgttctgtggcatcactggcctgaaacccacctacggccgggtatctcgattcggcatg
attgcctttgcctccagtcttgatcaggccggcccactctccaagagcgcggaagatgcc
gcactgatgatgaacgccatggccggtacggacctgcgcgactccaccagccttgaccat
ccggtggaagattttaccgcgctgctgcagaactcattgagcggtttgcgcatcggcctg
cccaaacagcactttactgccgatctgaatccggctgtgcagcagattctgcaggacgcg
atcaaagtactggaaggcctcggtgccagcgtcagtgaagttgacctgccgcataaccac
ctgtcagtgcctgcctactacgtggtggcaccggccgaagcgtctgccaacctgtctcgc
tttgatggcgtgcgctttgggtaccgctgcgaaaatccgctaaaccttgaggacctctac
aagcgcagccggggggaaggattcggagatgaagtgaaacggcgcatcatggtcggcact
tatgccctgtcggctggctattacgatgcctactacaaaaaagcacagaaaatccgtcgc
ctgatcaagcaggattttgatgacgcattcagggatgttgatgtaatcctgggacctact
tcgccacacactgcattcaagctgggtgagaaaaacagcgacccggtcaccatgtacctc
gaagatatatacaccatcgctgtcaacctggcgggcatacccggtatgtcgctgccagcg
ggtatgctgaacgggctgccgatcggcatgcaactggtcggacccgctttctctgaggcg
cgcttgctgaatgttgcccaccagttccagttgaataccaactggcacaccatgcgaccg
gaggtataa

DBGET integrated database retrieval system