KEGG   Pseudohongiella spirulinae: PS2015_856Help
Entry
PS2015_856        CDS       T04158                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pspi  Pseudohongiella spirulinae
Pathway
pspi00620  Pyruvate metabolism
pspi00680  Methane metabolism
pspi01100  Metabolic pathways
pspi01120  Microbial metabolism in diverse environments
pspi01200  Carbon metabolism
Module
pspi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pspi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PS2015_856
  09102 Energy metabolism
   00680 Methane metabolism
    PS2015_856
Enzymes [BR:pspi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PS2015_856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF463
Motif
Other DBs
NCBI-ProteinID: ALO45528
UniProt: A0A0S2KB55
LinkDB All DBs
Position
886977..889547
Genome map
AA seq 856 aa AA seqDB search
MSNETARLFEELVALNYQLYSSLFLKLPLDAIEQTGTLLPLLSEACERGLSEGKNAKSII
GEFFEQHREHFNEHEQIQFLFKIIQYVERQVVLIDALEDAAYSRIHQIDNKTSLIRLTER
AADDGRTDKLAQLLKNFGVRVVLTAHPTQFYPGQVLAIISDLTEAISGARTGEVRDLLQQ
LGNTPFFQKQKPSPYDEAVLLTWYLSNIFYQAIGELVDPLAQRFPEQINSNAELVSIGFW
PGGDRDGNPFVTTDTTLRVAARLRQSIIQCYHNDIRQLKRRLSFRDVYEALDKLEKQLRD
ELSEKPGREGVLLSDIHLVLDQVERLLSERYQSMYIDSLQSFRRKVTLFGFHFASIDIRQ
DSRVIARTLESIVQQQPGLLPMDFNSLNEDQQINAMLACKGEVDASRFDDPVIRDTIESF
SVIRRIQFTNGERGAHRYIISNCRGPVDVVRVLTLFRLCGWRDRPINVDIVPLFETIDDL
QRAGESMARLYANTQYQVHLSHRRQRQTVMLGFSDGTKDGGYLMANWGIYTAKEDVTAVS
RDQGVEVIFFDGRGGPPARGGGDTYLFYAAHGRTIESNQIQMTVQGQTISSYYGIKDAAK
HNLGQLLTAGLENNLLDRVDRELDDLQRNLIRDLAERSYQKYEAFKNHKLFMPYLEEMST
LKYYAMANIGSRPSKRGGGDAMKFEDLRAIPFVGAWSQLKQNVPGFYGLGSALKAQEELG
RLDACLELYEHSRFFRALISNSMQSMSKTNFELTRYMENDPQFGEFWQDIYQEYLISKEM
VLKISGQDQLLQDNPRSRMSIRLREEVVLPLLTIQQYALIRIRECREQDAAEQLAMYEKM
VVRTLFGNINAARNSA
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgaaactgcccggctttttgaagagctggtggccctgaactaccaactctac
agcagcctgtttctgaagctgccgctggatgctatcgaacagaccggcaccttgctgccg
ttgctgtcggaagcctgcgaacgcggattgtctgagggcaagaatgccaaatccataatt
ggcgaatttttcgagcagcaccgcgagcatttcaacgaacacgagcagatccagttcctg
ttcaaaattattcagtacgtagagcgccaggtcgtattgattgatgccctggaagatgct
gcttacagtcgaattcaccagatcgacaacaaaacctcactgatcaggctgaccgaaagg
gcggccgatgatggacgcaccgataagctggcgcagttactgaaaaactttggagtgcgt
gtggtgctcacagcgcatccaacacaattctacccagggcaagtgctagccattatatct
gacctgacagaagcgatttccggcgcgcgcactggcgaggtgcgggatcttttacagcag
cttggcaatacaccgttctttcagaagcaaaagccttccccttatgatgaggcagtgctg
ttgacctggtatctgagcaatattttttatcaggccattggtgaattggtagacccactg
gcacaacgctttccagaacagattaacagcaatgccgagttggtcagcattggtttctgg
ccaggcggggatcgtgatggcaatccttttgttaccaccgacacaacactgcgggttgcg
gccagactcagacagagcattattcagtgttatcacaatgacatccgtcaactgaagcgt
cgtcttagtttcagagatgtttatgaagctctggacaagctggaaaagcagctgcgcgat
gagctcagcgagaaaccggggcgcgaaggcgtgttactcagcgatattcacctggtgctg
gatcaggttgagcgactgctaagcgaacgttaccagtccatgtatattgattcactgcaa
tctttccgtcgcaaggtgactctgtttggtttccactttgcgagtattgatatccggcag
gatagccgggtgattgcccggacgctggagtccatcgttcagcaacagcccggtttgctt
ccaatggatttcaactccctgaacgaagatcagcagataaatgccatgctcgcctgcaag
ggcgaggtggacgccagccgattcgacgacccggtgattcgcgataccattgaatcattc
tctgtcatccgtcgcattcagttcaccaatggtgagcgcggtgcgcatcgctacatcatc
agtaactgccgaggtccggtggatgtggtgcgcgtactgaccctgttccgcctgtgcggc
tggcgtgaccgtccgattaacgtcgatatcgtgccgctgtttgaaaccatcgatgacctg
caacgtgccggagagtcgatggcccggctttatgccaatacccaataccaggttcacctg
tcgcatcgccgtcaacgccagacggtgatgctgggtttctcggatggcaccaaagatggt
ggctacctgatggccaactggggtatttacactgccaaggaggacgtgactgcggtgtcg
cgcgatcagggtgttgaggtaatcttctttgacggccgtggtggtccacccgcccggggt
ggtggtgacacgtatcttttttatgcggcgcacggcagaaccatcgaaagcaatcagatt
cagatgacggtgcagggtcagaccatcagctcttattacggcatcaaggatgcggccaag
cataatctggggcagttgctgacggcggggctggagaataacctgctggatcgtgtggat
cgtgagctggatgacctgcagcgtaatctgattcgtgatttggcagagcgcagctatcag
aagtacgaagcgttcaagaatcataagctgtttatgccttatctggaggaaatgagcacg
ctcaaatactacgccatggccaatatcggcagtcgcccctcaaaacgaggcggtggcgat
gccatgaagtttgaagatctgcgcgccattccttttgtgggtgcctggagtcagctcaag
cagaacgtacccggattttatggcctgggctcggcgcttaaagctcaggaagagctggga
cgcctggatgcctgtctggagctctatgagcattcgcgcttcttcagagcgcttatctcc
aacagcatgcagagtatgagcaaaaccaattttgagctgacccgctacatggaaaatgat
ccgcagtttggcgagttctggcaggatatctatcaggaatacctgatcagcaaggagatg
gttctaaaaatctccggtcaggatcagcttttgcaggataacccgcgcagccgcatgagc
atccgtctgcgggaagaagtggtgttgccactgctgaccattcagcaatatgcgctgatc
cgcatacgtgaatgccgcgagcaggatgccgcggagcaactggccatgtacgaaaaaatg
gtggtgcgaacgctgtttggcaatatcaacgcggccaggaattcggcttga

DBGET integrated database retrieval system