KEGG   Pseudoalteromonas spongiae: PSPO_a0089Help
Entry
PSPO_a0089        CDS       T05098                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pspo  Pseudoalteromonas spongiae
Brite
KEGG Orthology (KO) [BR:pspo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSPO_a0089 (ahpF)
Enzymes [BR:pspo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PSPO_a0089 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 NAD_binding_7 FAD_binding_3 AlaDh_PNT_C K_oxygenase NAD_binding_8 FMO-like Lycopene_cycl NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ATC97349
UniProt: A0A290SYX2
LinkDB All DBs
Position
I:89356..90930
Genome map
AA seq 524 aa AA seqDB search
MNSILDNNIKTQLQSHFSSIVDPVELVIALDDSTKSQEVKALANDLLGLSEHFLIREDDT
IERKPMLSIRSPKRGTEINFAGVPMGHEFTSLILALLHTGGVATKASELEVEQIKGLQST
LNFEVYISLSCQTCPGVVQALNTIAALNSNVTVTMIDGALFQNEVSERNILAVPSVYLNG
ELFSQGALTLSDIINKLDDGAAEKTAELLSQKDEFDVLVVGGGPAGASAAIYAARKGLKT
GIVAERFGGQVADTVGIENFISVQKTEGPKLVAQLEEHVKDYDVDIITQQKAVTLGKSGN
VEVALESGATLSSKSVILATGARWREMNVPGEQEYRGKGVAYCPHCDGPLFKGKKVAVIG
GGNSGIEAAIDLANIVEHVTVLEFADTLRADEVLIKKANSLDNIEIIKNAQTTEVIGDGT
RVTGLNYTDRVSGDAHSLSLSGIFVQIGLIPNTEFLKGSIELTPFGEIVIDDKGATSMPG
VYAAGDATTTPFKQIIIAMGSGATASLGAFDYLIRHADGTQQVA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtattttagataacaatatcaaaacacaattacagagccattttagcagtatt
gtcgaccctgtagagctggttattgccttagatgacagtacaaaatcacaggaagttaaa
gcattagcaaatgatttgttaggcctaagtgagcattttttaattcgtgaagacgataca
attgagcgcaaaccaatgctttcaattcgttcaccgaaaagaggcaccgaaattaatttt
gcaggtgtgccaatgggccacgaatttacaagcttaattttggcactgttacatacaggt
ggtgttgctaccaaagcaagtgagctggaagtggagcaaattaaggggctgcaaagtaca
cttaatttcgaagtgtatatttcgctgagttgccaaacatgtccgggagttgtgcaagca
cttaatacaattgcggctttaaattcgaatgttacggttactatgatcgatggcgcactg
ttccagaatgaagtgtcagagcgcaacattttagccgtaccaagcgtgtatttaaatggt
gagctatttagccaaggtgcacttacactcagtgacattatcaataagctggatgatggc
gcagcagaaaaaacagccgagctactgtcacaaaaagatgaatttgatgtacttgtagtt
ggtggtgggcctgcaggtgcttccgcagcaatttacgcggcgcgtaaggggttaaagaca
ggcattgtggctgagcgctttggtggccaagtggcagatactgttggcattgaaaacttt
atttcggtgcaaaaaactgaaggccctaaactggtggcacagcttgaagagcatgttaaa
gactatgatgttgatattattacccagcaaaaagcggttaccttaggtaagtctggcaac
gttgaagtggcactggaaagtggcgcaacactttcgagtaaaagcgtgattttggcaacg
ggtgcacgctggcgtgaaatgaatgtaccgggcgagcaagaatatcgtggtaaaggtgtt
gcttactgcccgcactgtgacggcccgctatttaaaggcaaaaaagtggctgtgattggc
ggtggtaactcaggcatcgaggccgctatcgatttagctaatattgttgagcatgttacc
gtattggagtttgctgatacgttacgtgcggatgaagtgttgatcaaaaaggccaacagc
ctagataatattgaaattattaaaaatgcgcaaactaccgaagttatcggtgatggcaca
cgagtaactggcctaaactatacggatcgtgtttctggtgacgcacatagcctttcactt
tcgggtatttttgtacaaattggtttaattccaaatactgaattcttaaaaggtagtatc
gaattaaccccatttggtgagattgttattgatgataaaggcgctacatcaatgccaggt
gtttacgctgcgggtgatgcgacaactaccccatttaaacaaattattattgccatgggc
agtggggcaacagcaagtttaggtgcatttgattatttaattcgccacgctgatggcacg
cagcaagtagcataa

DBGET integrated database retrieval system