KEGG   Pseudoalteromonas spongiae: PSPO_a1446Help
Entry
PSPO_a1446        CDS       T05098                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pspo  Pseudoalteromonas spongiae
Pathway
pspo00500  Starch and sucrose metabolism
pspo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pspo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSPO_a1446
Enzymes [BR:pspo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PSPO_a1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ATC98524
UniProt: A0A290T2J5
LinkDB All DBs
Position
I:1360204..1362633
Genome map
AA seq 809 aa AA seqDB search
MTTSEKLTMFKTKFVKQSLLASAVALAISGCGAEVAKTNSESTAQNNLTAPGAPGSKPFW
AYSGKTGIGTSYEAYLDGSYSDKAATGPVSKVWFSLAQGIITETMFGLIHQAQLKEMQFV
VKGDNFIATELDDTQWQIDYLQKDELGRPLSLAYKLTNTDKQGRFKIEKHIFTDSNNQTL
FVKVVLESLKGEPLSLYVHANPYVNNNGVGDKATVKEGKLVAVDGDNYLTLSSNTTFEQA
SVGFVGTSDLISQMKSGKTFISYATTGDKTGNVSLDALLGSTSSKAEFDLTLSFGNTLDE
SIAAANASQQKGYQALLTEFGADWQSYLASLDLEALSSQSADNGRLAYASALVLKAQEDK
THAGALIASLSNPWGDTVPAIEGHTGYKAVWVRDFYQVAMAFLAMGDKATAKTAFEYLEK
VQVTDKTPGNQGDTGWFLQKTHVDGELEWVGVQLDQTAMPIMLGWKLYLADVLSKEELIL
WFNKMLKPAADFLVEGGLAKILWNDTEIKPPFTQQERWEEQAGHSPSTTAAVIAGLITAS
EIAKLAGDDTLATKYLNVAKDYNAKVESRMYTTKSTLPSDASNGQHYVRISQDDDANSAT
VLGDNNGRKGLVKQSILDGGFLELVRYGVRSAEDKHIIDTLDEYDAQNLPENLKVKYNFT
FEGVKGQFPGWRRYGNDGYGEDEVTGTNYAEGGNNTPGQRGRVWPFFTGERGHYEIAKLV
QSDSFDTKQQAALTQTYVKGMEQFANEGLMLPEQVWDGVGVNPHNYTFGEGTNSATPLAW
THAEYIKLLRSMSDKQVWDYYPVVKEKLN
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaagtgaaaaattaaccatgtttaaaactaaatttgttaaacaatcattgctt
gcaagcgcagtagcacttgcaatttctggctgtggtgctgaagtggcgaaaactaactca
gaaagtacagcgcaaaacaatttaacggcaccaggcgcaccaggtagcaaaccgttctgg
gcttattcaggcaaaaccggtattggtaccagttacgaagcgtatttagatggcagctac
agcgataaagcggcaacaggcccggtttcaaaagtgtggttctcattagcgcaggggatt
attaccgaaaccatgtttggtttaattcatcaagcacagttaaaagaaatgcaatttgtt
gttaaaggcgacaacttcattgctacagaacttgatgatacccagtggcaaattgactac
ctacaaaaagatgagctaggcagacccttgtcacttgcttacaagttgacgaatactgac
aaacaaggccgctttaaaattgaaaagcacatttttactgatagcaacaatcaaacgtta
tttgtaaaagtggtattagaatcacttaaaggcgagccattatcactttatgtgcatgct
aacccgtatgttaataataacggtgttggcgataaagccacggtgaaagaaggtaaatta
gtagcggttgatggcgataattatctgacactttcaagtaacacaacatttgaacaagcg
agtgtaggttttgttggtacatctgatttgatatcacaaatgaagtcgggcaaaacgttc
ataagctatgcaacaaccggtgataaaacgggtaacgtgtcgcttgacgccttacttggc
agcacatcaagcaaagcagaatttgatttaacactgtcatttggtaacaccttagatgag
agtattgcggcagcaaacgcaagccaacagaaaggttaccaagcactattaactgaattt
ggtgctgattggcagagttatttagcatcgcttgatcttgaagcgctaagctcacaatca
gctgataatggccgcttagcgtatgcaagtgccttagtgttaaaagcgcaggaagataaa
acacatgcgggcgcattgattgcatcactgtcaaacccttggggtgataccgtacctgca
attgaagggcataccggatataaagctgtttgggtacgtgatttctaccaagtagcaatg
gcgtttttagctatgggtgataaagccaccgctaaaaccgcgtttgaatatttagaaaaa
gtacaagtgacggataaaacaccgggtaaccaaggtgatacgggctggtttttacaaaag
acccatgttgacggtgaactagaatgggtgggtgttcagctggaccaaacagctatgcca
attatgcttggttggaagctttatcttgccgatgtgcttagcaaagaagaactgatcctt
tggtttaacaaaatgctcaaacctgcggctgattttctagttgaaggtggtcttgctaaa
attttatggaatgacaccgaaataaagccgccatttactcagcaagaacgttgggaagag
caagcggggcattcgccatcaaccactgctgctgtaattgctggtcttattacggcaagt
gaaattgcaaagctggcaggcgatgataccttggctactaagtacttaaatgtagcaaaa
gattacaatgccaaagttgaatcgcgcatgtataccactaaaagtacgttaccaagtgat
gcatcaaacggccagcactatgtacgcattagccaagatgacgatgcaaactcagcgacg
gtgctaggcgataacaatggccgcaaaggtttagtcaaacaaagcattttggatggcggc
tttttggaacttgtgcgttatggtgtaagaagcgctgaagataagcatattattgatacg
cttgatgaatatgatgcacaaaatttacctgaaaaccttaaagtaaaatataactttact
tttgagggggtaaaggggcaattcccaggctggcgtcgctacggtaatgacggttatggt
gaagacgaagtgactggcaccaactacgccgaaggtggtaataataccccagggcaacgt
ggacgtgtttggccgttctttaccggtgaacgaggccactatgaaattgcaaaactcgtg
caatctgattcgttcgatacgaaacagcaagccgcattgacgcaaacctatgtaaaaggc
atggaacaattcgccaacgaaggcttaatgttaccagagcaagtgtgggatggtgttggt
gttaacccgcataattacacatttggcgaaggcacaaattcagcgacaccacttgcatgg
acacacgccgaatatattaaattattgcgttcaatgtcagacaaacaagtttgggactac
tacccagtagtcaaagaaaagttgaattaa

DBGET integrated database retrieval system