KEGG   Pseudoalteromonas spongiae: PSPO_a1844Help
Entry
PSPO_a1844        CDS       T05098                                 

Definition
(GenBank) peptidyl-dipeptidase A
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pspo  Pseudoalteromonas spongiae
Brite
Enzymes [BR:pspo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     PSPO_a1844
Peptidases [BR:pspo01002]
 Metallo Peptidases
  Family M2
   PSPO_a1844
Exosome [BR:pspo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSPO_a1844
CD molecules [BR:pspo04090]
 Proteins
  PSPO_a1844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ATC98878
UniProt: A0A290T3K1
LinkDB All DBs
Position
I:1739492..1741324
Genome map
AA seq 610 aa AA seqDB search
MTSFKLSLPALLVASAVAITGCNATSKQQETQSAQQVTAQDAKAFLANTETELMALYNEV
SRAEWIYANFITHDTSGLSAAANEKMTAAVVRLANEASKFDKLDLDEDSRRKLDKLKLAL
TLPAPQDPAKTAELSKIVAELGGLYGKGKYCKEDDKCLSLGDMTATMATSRDYDELLDIW
TGWREVAKPMRPLYEQQVELTNQGANELGYADTGAMWRSKYDMPADDFAKELDRIWGQVK
PLYNSLHCHVRAKLGEKYGEDKVPQDKPIPAHLLGNMWAQTWGNIYDVVAPANADPGYDV
TELLAKHNYDELKMVRGAEKFFTSMGFAPLPETFYERSLFTKPQDRDVQCHASAWNLDSK
DDLRIKMCIQRTGEEFSVIHHELGHNFYQRAYNTQPIYYQESANDGFHEAIGDTIALSVT
PGYLKEIGLLDEVPDESKDIGLLMKMAMDKIAFIPFGLLVDQWRWKVFSGEVTPENYNQA
WWELREKYQGVAAPVARTEEHFDPGAKYHVPGNTPYTRYFLAHILQFEFHRALCEIAGSK
ESIHRCSVYNSKEAGERLDAMLKMGSSRPWQEALASVTGKPEMDATAILDYFAPLQKYLD
EQNKGRQCGW
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgacatcatttaaactctcactacccgcattactcgtcgcatcagcggtcgcgattact
ggctgtaatgcaactagcaaacagcaagaaacacaatcggcacaacaagtaacagcacaa
gacgcaaaagcgtttttagcaaatactgaaacagaattaatggcgctttataacgaagtt
agccgtgctgagtggatttacgcaaactttattacgcacgatacgtcaggcctatctgct
gcagcaaacgaaaagatgactgctgctgtagttcgtttagcaaatgaagcgtctaaattt
gataagttagacctagacgaagatagccgccgtaaactagataaactgaagcttgcactc
accctgcctgctccacaagatccagctaaaactgctgagctttcgaaaatcgttgctgaa
cttggcggtctttacggtaaaggtaaatactgtaaagaagacgataagtgcttaagcctt
ggcgatatgactgcaaccatggcaacaagccgtgattacgacgaactacttgatatttgg
actggttggcgcgaagttgctaaaccaatgcgtcctctttacgagcaacaggttgagtta
acaaaccaaggcgcaaacgagcttggctacgcagatactggcgctatgtggcgcagtaaa
tatgatatgcctgccgatgactttgccaaagagttagaccgtatttggggtcaagttaaa
ccgctatataattcactacactgtcacgttcgcgcaaaactgggcgaaaagtacggtgaa
gacaaagtaccacaagataagccaattccagcacacttgcttggtaacatgtgggcacaa
acgtggggtaatatctacgatgtagttgcacctgcgaacgccgatccgggttatgatgta
actgaattgcttgctaagcacaactacgacgaactaaaaatggtgcgtggtgctgagaaa
ttctttacgtcaatgggctttgcaccattacctgagacattctacgagcgttcactgttt
actaaaccacaagatcgcgacgtgcaatgtcacgcttcagcttggaacttagatagcaaa
gacgatttacgtattaagatgtgtatccaacgtactggtgaagaattctcagtaattcac
cacgaactgggccacaacttctaccaacgcgcttacaacacgcaaccaatttactaccaa
gaaagtgctaacgatggcttccacgaagcaattggcgacactatcgccctttctgtaaca
cctggttacttaaaagaaatcggtttacttgatgaagtaccggatgaatcaaaagatatc
ggtcttctaatgaaaatggcaatggataaaattgcatttattccatttggcctacttgtt
gaccaatggcgctggaaagtattctctggtgaagtaacacctgagaactacaaccaagcg
tggtgggaactgcgtgaaaagtatcaaggtgttgcggctcctgtagctcgtactgaagaa
cactttgatccaggtgcgaaataccatgtaccaggtaacacaccttatacacgttatttc
ttagcgcatattctacaatttgaattccaccgcgcattatgtgaaatcgcaggcagcaaa
gagtctattcaccgttgtagtgtttataactcaaaagaagctggtgagcgtttagatgcg
atgctgaaaatgggttctagtcgcccatggcaagaagcgcttgcaagcgtaacaggtaaa
ccagaaatggatgcaacagcaattcttgattactttgcaccattacaaaaatacctagac
gagcaaaacaaaggccgccagtgcggttggtaa

DBGET integrated database retrieval system