KEGG   Pandoraea sputorum: NA29_12925Help
Entry
NA29_12925        CDS       T03554                                 

Definition
(GenBank) hypothetical protein
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pspu  Pandoraea sputorum
Pathway
pspu00020  Citrate cycle (TCA cycle)
pspu00190  Oxidative phosphorylation
pspu00650  Butanoate metabolism
pspu01100  Metabolic pathways
pspu01110  Biosynthesis of secondary metabolites
pspu01120  Microbial metabolism in diverse environments
pspu01130  Biosynthesis of antibiotics
pspu01200  Carbon metabolism
Module
pspu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pspu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pspu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pspu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NA29_12925
   00650 Butanoate metabolism
    NA29_12925
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NA29_12925
Enzymes [BR:pspu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NA29_12925
    1.3.5.4  fumarate reductase (quinol)
     NA29_12925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO FAD_binding_3 FAD_oxidored HI0933_like GIDA
Motif
Other DBs
NCBI-ProteinID: AJC16687
UniProt: A0A239SEQ8
LinkDB All DBs
Position
1977997..1979751
Genome map
AA seq 584 aa AA seqDB search
MKVIDCDVVVVGGGGAGTYAALRLHDLGLKPMLISKGLVGKSGASIMAGAVIVGSKMLGG
NAQNAASSLEFFAKYYSHFLVDQSYLAAAGHWIENTFYPEMESLGLLFSREADGQIAMSH
SPVRWAVAPMQGQTGMLLMDIRRKQLQARGIPMHEECVVTALLRNENGEVCGLTALDYVR
GEMFAVHARAVVMATGHADRMVRRSTGTREQTGDGIALALRAGAEMTNLEMQFWHISDFA
HPPTWQRLHIYPNPLVGTNQSSRVYNAQGECFFEQSRDAPAALAPYTLQVKRLTQQVLAG
KARFSGGYYTSYSHVDADVLRRYQYAGSAFEKLGLDITRDKVEARPTMHYRQGGIESDPH
SMRTSVDGLWVAGGVGAHVTGSLAVAIYDGGLVAESIAGSLPDRHRHDGLTEQQIRAEES
RVEGVRLRADAGGQTADGETGRQALAPMHVKTGIWDVMDAAYGLIKSGEAMRAGLARLAA
MRERELPRMTPPSTSRRFNTAWLDALDAHNLIDVCEVTLQSALKREESRGSFYRTDFPYV
DNTAWQCKNIVALDGGAYRFRRERYPEGAIAPGFERQEYFSVPW
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatcgattgcgatgtcgtagtcgtgggcggcggcggtgcgggcacctatgcc
gcgctccgtctgcacgacctgggattgaagccgatgttgatatcgaaggggctggtcggc
aagagcggtgcgtcgatcatggccggagcggtgatcgtcggctcgaagatgctcggcggc
aacgcgcagaacgccgccagttcgctcgaattcttcgcgaagtactacagccactttctg
gtcgatcagtcctatctggcggcggcggggcactggatcgagaacaccttctatcccgag
atggagtcgctcggtttgttgttttcgcgggaggccgacgggcagatcgcgatgagccac
tcgccggtgcgctgggcggtcgcgccgatgcaggggcagaccggcatgttgctgatggat
atccgacgcaagcagttgcaggcgcgcggcattccgatgcatgaggagtgtgtcgtgacg
gcgctgctgcgcaacgagaacggcgaagtttgcgggctgactgcgctcgactacgtgcgc
ggcgagatgttcgcggtgcatgccagggccgtcgtgatggcgaccgggcacgctgaccgg
atggtgcgtcgctccacgggaacgcgggagcagaccggcgacggcattgcgctggcactg
cgcgcgggggctgagatgactaatctggagatgcagttctggcacatcagcgactttgcg
catccaccgacgtggcagcgtctgcacatctatccgaatccgcttgtcggcacgaatcaa
agttcgcgcgtgtacaacgcgcaaggcgagtgcttcttcgagcagtcgcgcgacgcgcct
gccgcgctcgcgccgtacacgcttcaggtcaagcgactcacgcaacaggtgctcgcgggc
aaggcacgcttcagtggcggctattacacgtcatacagccacgtcgatgcggatgtgtta
cggcggtaccagtacgccggttctgcgtttgaaaagctggggctcgacatcacgcgcgac
aaggtcgaggcgcgccccacgatgcattaccggcaaggcggtatcgagtcggatccccat
tcgatgcgcaccagtgtcgacggattgtgggtcgcagggggcgtgggcgcgcatgtcacg
gggagtctggccgtcgcgatttacgacggtgggctggtggccgagtcgattgctggcagc
ttgccggaccgacatcgtcacgatggcctgaccgagcagcagattcgggcagaagaatcg
cgggtggagggggtgaggctcagggcggatgcgggcggccagacggctgacggcgagacc
gggcggcaggcgctcgcccccatgcacgtcaagacgggcatctgggacgtgatggacgcg
gcatacggattgatcaagagcggggaggccatgcgcgccggtctggcgaggcttgccgcg
atgcgagagcgcgaactgccgcgcatgacaccgccgagcacctcgcgccggttcaacacc
gcgtggctcgatgcgctcgacgcccacaacctgatcgacgtgtgcgaagtcacgctgcaa
agcgcgttgaagcgagaagaaagccgaggcagtttctaccggacggactttccgtacgtc
gataacaccgcatggcagtgcaagaacatcgtcgcgctcgacggcggcgcttatcggttc
cggcgggagcgctaccccgagggagccatcgcgcccggattcgagcgacaggagtatttc
agcgtgccgtggtga

DBGET integrated database retrieval system