KEGG   Pandoraea sputorum: NA29_12930Help
Entry
NA29_12930        CDS       T03554                                 

Definition
(GenBank) hypothetical protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pspu  Pandoraea sputorum
Pathway
pspu00020  Citrate cycle (TCA cycle)
pspu00190  Oxidative phosphorylation
pspu00650  Butanoate metabolism
pspu01100  Metabolic pathways
pspu01110  Biosynthesis of secondary metabolites
pspu01120  Microbial metabolism in diverse environments
pspu01130  Biosynthesis of antibiotics
pspu01200  Carbon metabolism
Module
pspu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pspu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pspu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pspu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NA29_12930
   00650 Butanoate metabolism
    NA29_12930
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NA29_12930
Enzymes [BR:pspu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NA29_12930
    1.3.5.4  fumarate reductase (quinol)
     NA29_12930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_9 Fer4_17 Fer2 Fer4_21 Fer4_7 Fer4_18 Fer4_10 Fer4 Fer4_4 Fer4_6 Fer2_4 Fer4_2
Motif
Other DBs
NCBI-ProteinID: AJC16688
UniProt: A0A239SEV7
LinkDB All DBs
Position
1979828..1980793
Genome map
AA seq 321 aa AA seqDB search
MHSDVGQFRGDSDSDSELTTVTLHISRFDPETDAAPYMQTYAVPTVPHMRIIDALNYVQE
VLGVDIGYRWYCGTKKCGTCAVRMNGREVLACWEAAQAEMHVEPLRHLPLIRDLAVDRAP
AEAKLVSLQTWLQRTRPYGGFPEPVDAANAATLRATMDCLSCLACYSACPVLDFPEDIAF
AGPAPLVHLARVALDARDDASRLQAILDEAHVHHCVSCYQCEAVCPAHIPIVSAAIEPLK
QLAYARAPEASPHARAFMEIVERRGRIEPMLLVLGTRGWRAALQRPGRTLKLMLRGKVRP
LAALLRRPVQGIEAIRRIFFG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcattcggacgtcgggcaatttcggggtgatagcgatagcgacagtgagctgacgaca
gtaacgctgcacatttcgcgtttcgatccggagacggacgctgcgccctatatgcagacc
tacgcggtgccgacggtgccgcacatgcgaatcatcgacgcactgaactatgtacaggaa
gtgctcggggtggacatcggctaccgatggtattgcggcacgaagaagtgcggtacgtgc
gcggtgcggatgaacggtcgggaggtgctggcgtgctgggaggcggcgcaagcggagatg
catgtcgaaccgctgcgtcatctgccgttgattcgcgatctggcggtcgaccgggcgccg
gccgaggcgaagctggtctcgttgcagacctggctccagcgcacgcgtccgtatggcggg
tttcccgagccggtcgacgccgcaaacgccgcaacactccgggcgacgatggattgcctc
agttgtctggcgtgctattcggcgtgtccggtgctcgattttcccgaggacatcgcgttc
gcggggcctgcgccattggtgcatctggcccgcgttgcgctggatgcccgggacgacgct
tcccgtctgcaagccattctggacgaggcgcatgtccaccattgcgtctcctgctaccaa
tgcgaagcggtctgccccgcgcatattccgatcgtgagtgccgctatcgaaccgctcaag
cagttggcgtatgcgcgtgcgccggaggcgtcgccgcatgcgcgcgcgttcatggagatc
gttgagaggcgcgggcgcatcgagcccatgttgctggtgcttgggacgcgtggctggcga
gccgcgctgcaacgtcccggacggaccttgaagctgatgctgcgcggcaaggtgcggccg
ctggcggcgctgttgcgccgacctgtgcaggggatcgaggcgatccggcgcattttcttt
ggttga

DBGET integrated database retrieval system