KEGG   Pandoraea sputorum: NA29_15775Help
Entry
NA29_15775        CDS       T03554                                 

Definition
(GenBank) 2,2-dialkylglycine decarboxylase
  KO
K00596  2,2-dialkylglycine decarboxylase (pyruvate) [EC:4.1.1.64]
Organism
pspu  Pandoraea sputorum
Brite
KEGG Orthology (KO) [BR:pspu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pspu01007]
    NA29_15775
Enzymes [BR:pspu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.64  2,2-dialkylglycine decarboxylase (pyruvate)
     NA29_15775
Amino acid related enzymes [BR:pspu01007]
 Aminotransferase (transaminase)
  Class III
   NA29_15775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AJC17069
UniProt: A0A239SK78
LinkDB All DBs
Position
complement(2618475..2619776)
Genome map
AA seq 433 aa AA seqDB search
MSKNQDAEFWRNAREHLIRYGGTFEPMIVERAQGSFVYDADGRAILDFTSGQMSAVLGHS
HPDIVSVVTESIGKLDHLFSGMLSRPVVDLATRLAEITPEGLDRVMLLSTGAESNEAAIR
MAKLVTGKYEVVGFAQSWHGMTGAAASATYSAGRKGVGPAAVGSFAIPAPFTYRPRFGPA
GQYDYLAELDYAFDLIDRQSSGNLAAFIAEPILSSGGIIELPPGYLAALKRKCEERGMLL
ILDEAQTGIGRTGTMFAFERDGVTPDILTLSKTLGAGLPLAAIVTSAQIEERAHERGYLF
YTTHVSDPLPAAVGLRVLDVVARDGLVARANVMGERLRNGLLGLMERFDCVGDVRGRGLL
LGMEIVKDRRTKAPADGLGAKITRECMNLGLSMNIVQLPGMGGVFRIAPPLTVSDEEVDL
GLSLLGQAIERSL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaagaaccaagacgccgaattctggcgcaatgcccgcgagcatctgatccgctac
ggcggcaccttcgagccgatgatcgtcgagcgcgcccagggcagcttcgtctacgacgcc
gacgggcgcgcgatcctcgacttcacctccgggcagatgagcgccgtgctcggccacagc
catccggacatcgtctcggtggtgacggaatctatcggcaagctcgaccacctgttcagc
ggcatgctttcgcgtccagtcgtggatctggccacccggctggccgagatcacccccgag
ggactggaccgcgtgatgttgctgagcactggcgcggagtcgaacgaggcggccatccgc
atggccaagctcgtcaccggcaagtacgaagttgtaggttttgcacagtcttggcatggg
atgacgggcgcagccgcgtccgcaacctacagtgcgggacgcaaaggcgtcggcccggcg
gccgtgggctcgtttgccattcccgcgccgttcacgtaccgtccgcgcttcggccctgcc
ggtcaatatgactacctcgccgaactggattacgccttcgatctgatcgatcgtcagtcg
agcggcaatctggccgcgttcatcgcagaaccgatcctgagttccggcggcatcatcgaa
cttccacccggctacctcgccgccttgaagcgcaagtgcgaggagcgcggcatgttgctg
attctcgacgaagcgcagaccggcatcggacgcaccggcaccatgttcgcgttcgaacgc
gacggcgtgacgcccgacattctgaccctctcgaagacgctcggtgcgggccttccgctc
gcagccatcgtgacgtcggcgcaaatcgaggagcgcgcccacgaacgcggctatctgttc
tacacgacccacgtttccgacccgctaccggcggctgtcggcttgcgcgtgctcgacgtg
gtggcgcgcgacggactcgtcgcccgcgccaacgtgatgggtgagcggctgcgcaacggc
ttgttgggattgatggagcgcttcgattgcgtgggcgacgttcgcggacgcggcttgctg
ctcggtatggagattgtgaaggaccgacgcaccaaagcgcccgctgacggcctcggcgcg
aagatcacgcgtgaatgcatgaacctaggtctgagcatgaacattgtgcagttgcccggc
atgggcggcgtgttccgtatcgcgccgccgctgaccgtcagcgacgaagaagtcgatctg
ggactgtcgttgctcggacaggcaatcgagcgttcactgtag

DBGET integrated database retrieval system