KEGG   Pandoraea sputorum: NA29_21680Help
Entry
NA29_21680        CDS       T03554                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pspu  Pandoraea sputorum
Pathway
pspu00620  Pyruvate metabolism
pspu00680  Methane metabolism
pspu01100  Metabolic pathways
pspu01120  Microbial metabolism in diverse environments
pspu01200  Carbon metabolism
Module
pspu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pspu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NA29_21680
  Energy metabolism
   00680 Methane metabolism
    NA29_21680
Enzymes [BR:pspu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NA29_21680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJC17919
UniProt: A0A239SNI9
LinkDB All DBs
Position
3997435..4000434
Genome map
AA seq 999 aa AA seqDB search
MKSSAKAKAPKEGLAKSVGKTSPAKAVAAVSSPPSKRSGQKANGQDKSISTAAAPKARRS
REDKDAPLREDIRFLGRLLGDVLREQQGSDAFDLVETIRQNAVRFHREGDRSAAKALDSL
LNGLTNEQAIQVVRAFSYFSHLANIAEDRHHNRRRRVHALAGSRAQQGSLSAALQSLKDA
GRDDPATLQAFFASALIVPVLTAHPTEVQRKSILDAEREIARLLEHRDDALTERESSRNT
DSMRAYVTTLWQTRMLRSSRLTVADEIENALSYYRSTFLSEIPALYDDVAAELHDAVPSV
RSEGLGRFLQMGSWIGGDRDGNPNVTAQTLQLAITRQATEIFAHYLEEVHLLGAELSVSQ
LLAGASDALLTLARRSPDDSPHRTDEPYRRALIGVYARLAATARDWVGHVPHRGAVGNAS
PYHDASEFISDLNTVVASLMAHHGSALVSQRLGPLVRAAEVFGFHLASIDLRQSSDIHEA
VIAELFAKAGVQANYAKLDENEKLALLLRELREARPLFSPYLDYSQRTRDELAVFSAARD
IRARFGARAVRNYIISHTETVSDLVEVMLLQKETGLFQGALDSDGGDGAKAIASKVGPMV
IPLFETIADLRNAPVIMREFFDIPGMSNVVTQQGGEQEVMLGYSDSNKDGGFLTSNWELY
KAELALVHLFEEKGIRLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEIIA
SKFANPEIGRRNLETIVAATLEATLLPSLNQPPRLAAYEQVMQTLSDTAFKAYRDLVYET
PGFTDYFFSATPIAEIAELNIGSRPASRKFSDPKNRRIEDLRAIPWGFSWGQCRLLLTGW
YGFGSAVSAYLDGDGSKADAAGRDKRLDTLRQMVKRWPFFANLLSNMDMVLAKTDLAVAS
RYAELVADEKLRKRVFNRIVGEWQSTSQALALITGHDERLADNPMLARSIKNRFPYLDPL
NHLQVELLRRHRAGESDERARRGIHLSINGIAAGLRNTG
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcagcgcaaaggcgaaagccccgaaagagggcctggccaagtcggtcggcaag
acgtcccccgcgaaggcagtagccgcggtttcatcccccccatccaagcgctcgggccag
aaggccaacgggcaggacaagtccatctccaccgctgctgcgcccaaagcgcgccgctcg
cgtgaggacaaggacgcgccgctgcgtgaggacatccgctttctcggccgcctgctgggc
gacgtgctgcgcgagcaacagggcagcgatgccttcgatctggtcgaaaccatccgccag
aacgcggtgcgctttcaccgcgaaggcgaccgcagcgccgccaaagcgcttgattcgctg
ctcaacgggctgaccaacgagcaggccattcaggtcgtgcgcgccttcagctacttctcg
cacctcgcgaacatcgccgaagaccgccaccacaaccgccgccgccgcgtgcacgcgctc
gcgggcagccgtgcccagcaaggcagcctgagcgccgcgctgcaaagcctgaaggacgcc
gggcgcgacgaccccgccacgctgcaagccttcttcgccagcgcgctcatcgtgccggtg
ctcaccgctcacccgaccgaagttcagcgcaagagcattctcgacgccgagcgcgaaatc
gcccgtctgctcgaacatcgcgacgacgccctcacggagcgcgagtcgtcacgcaacacc
gattcgatgcgcgcgtacgtcacgacgctgtggcagacccgcatgctgcgtagctctcgt
ctgacggtggccgacgaaatcgaaaacgcgctgtcgtattaccgcagcacgttcctgtcc
gaaatcccggcgctgtacgacgacgttgccgcagagctgcacgatgccgtaccgagcgtg
cgctccgaggggctgggccgcttcctgcaaatgggtagctggatcggcggagaccgcgac
ggcaatccgaacgtgacggcgcagacgctgcagttggcgatcacgcgtcaggcgacggaa
atcttcgcgcattacctcgaagaggtgcacttgctgggggcggagttgtccgtctcgcaa
ttgcttgcaggtgcgagcgatgcactgctcacgctggcccgccgctcgccggacgactcg
ccgcaccgcaccgacgaaccttatcgacgcgccctcatcggcgtgtacgcgcgactggca
gcgactgcgcgcgactgggtcggccacgtgccacatcgcggcgccgtcggcaacgccagt
ccgtatcacgacgccagcgagttcatctccgacctgaatacggtcgtcgcctcgctcatg
gcgcaccacggcagcgcgctggtctcgcagcgcctcgggccgctcgtgcgcgccgccgaa
gtgttcggcttccatctcgcgagcatcgacctgcgtcaaagctccgacattcacgaagcg
gtcattgccgagttgttcgcgaaggccggcgtccaggcgaattacgccaaactcgacgag
aacgaaaagcttgcgctgctgctgcgcgaactgcgcgaggcgcgtccgcttttctcgccg
tacctcgactactcgcaacgcacccgcgacgaacttgccgtcttctcggcggcgcgcgac
atccgcgcccgcttcggcgcgcgggcggttcgcaactacatcatctcgcatacggaaacc
gtaagcgatctggtcgaagtgatgctgctgcaaaaggagacgggactctttcagggcgcg
ctcgacagcgacggcggcgacggtgcgaaagccatcgcgtcgaaggtcggcccgatggtc
atcccgctgttcgagacgattgccgacttgcgcaacgcgcccgtcatcatgcgggagttc
ttcgatatccccggcatgtcgaacgtcgtaacccagcaaggcggcgagcaggaagtgatg
ctcggctactccgacagcaacaaggatggcggcttcctcacgtccaactgggagctgtac
aaggccgaactggcgctggtgcatctgttcgaggaaaaaggcattcgtctgcgtctcttc
cacggccggggcggtaccgtcggccgtggcggtggcccgacctatcaggccattctctcg
cagccgccgggcaccgtgaacggccagatccgcctgacggagcaaggcgagatcatcgcc
agcaagttcgcgaacccggagatcggacgccgcaatctcgagaccatcgtcgccgccacg
ctcgaagccacgctgctgccaagtctgaaccagccgccgcgtctggccgcgtacgagcaa
gtcatgcagacgctctccgacacggccttcaaagcgtatcgcgatctggtctacgaaacg
ccgggcttcaccgactacttcttctcggccacgccgattgccgaaatcgccgagctgaac
atcggttcgcgtccggcgtcgcgcaaattctccgatccgaagaaccgtcgcatcgaagac
ctgcgtgcgatcccgtggggcttctcgtgggggcagtgccgcttgctgctcaccggttgg
tacggcttcggcagcgccgtgagcgcgtatctggacggcgacggcagcaaggcagacgcc
gccggtcgcgacaaacgtctcgacacgctgcgtcagatggtcaagcgctggccgttcttc
gcgaacctgctttccaacatggacatggtgctcgccaagacggatctggccgtggcatcc
cgctatgccgagctcgtggccgacgaaaagctgcgcaagcgcgtgttcaaccggatcgtc
ggcgagtggcagagcacgtcgcaggcactggcgctgatcaccgggcacgacgagcgcctg
gcggacaacccgatgctcgcgcgctcgatcaagaaccgtttcccgtatctcgacccgctc
aatcacttgcaggtcgagctgctgcggcgtcaccgcgccggagagtcggacgagcgcgcg
cgtcgcggcatccatctgtcgatcaacggcatcgcagcgggccttcgcaatacaggctga

DBGET integrated database retrieval system