KEGG   Pandoraea sputorum: NA29_22815Help
Entry
NA29_22815        CDS       T03554                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pspu  Pandoraea sputorum
Brite
KEGG Orthology (KO) [BR:pspu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NA29_22815
Enzymes [BR:pspu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NA29_22815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO FAD_oxidored HI0933_like Glutaredoxin Thi4 NAD_binding_8 FAD_binding_3 K_oxygenase FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AJC18084
UniProt: A0A239SPA9
LinkDB All DBs
Position
complement(4250928..4252520)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKAQLQTYLQKVTRPIEIAVWLDDSPKSAEMKALVEEIAPLSDKIAVVARTDADE
RRPSFAIGTPGEAPRIRFAGLPMGHEFTSLVLALLQVGGHPLKLDDDTIEQVRALDGDFR
FETYISLSCQNCPEVVQALNVMALINPRIQQVTIDGALFQSEVEARQVMAVPTVFLNGES
FTQGRTSVKELLAKLDTGATARAAKALENKPVYDMLIVGGGPAGAAAAIYAARKGIATGV
VAERFGGQVLDTMAIENFVSVTHTEGPKFATALEQHVKTYDVDVIDTQRAEALIPGKIHE
VHLASGAVLKARAVVLATGARWREIGAPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKDVTLIEYGTQLRADEVLQRKLRSLPNVRVLMNAQTTEIVGDGQKV
NGLTYLNRATGERSTIALEGVFVQIGLVPNTEWLKGTVSLSRHGEIEVDAKGTTSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFEHLMLSSVDDEVDAERNEAAVA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcgaacctcaaagcccagttgcaaacgtatctccagaaagtcacgcgcccc
atcgaaatcgccgtgtggctcgacgatagccccaagtctgcagaaatgaaggcgctggtc
gaagagatcgccccgctgtcggacaagatcgccgtcgtagctcgcaccgatgccgacgag
cgtcggccgtcgttcgcgatcggcacgccgggcgaggcaccgcgtattcgttttgccggg
ttgccgatgggccatgagttcacgtcgctggtgctggcattgctgcaagtcggcggtcac
ccgctcaagctcgacgacgacaccatcgaacaggttcgcgcgctcgatggcgacttccgc
ttcgagacgtatatttcgctgtcgtgccagaactgcccggaggtcgtgcaggcgctgaat
gtgatggcgctgatcaacccgcgtatccagcaagtcaccattgacggtgcgctgttccag
agcgaagtggaagcgcgtcaggtgatggctgtgccgacggtgttcctcaacggtgaatcg
ttcacgcaaggccgtaccagcgtgaaggaactgctggcgaagctcgacacgggcgcgacg
gcgcgtgcagcgaaggcgctggaaaacaagccggtctacgacatgctgatcgtgggcggc
ggcccggcaggcgcggcggccgcgatttacgctgctcgcaagggcattgcgacgggtgtc
gtcgctgagcgtttcggcggtcaggtgctcgacacgatggccatcgagaacttcgtctcc
gtcacgcacacggaagggccgaagttcgccactgcgctcgaacagcacgtgaagacgtac
gacgtcgacgtgatcgacacgcaacgtgccgaagcgctcatcccgggcaagattcacgaa
gtgcatctggccagcggcgcggtgctcaaggcgcgcgccgtggtgctggccaccggtgca
cgctggcgcgaaatcggcgcgccgggcgagcgcgaataccgcaatcgcggcgtggcctac
tgcccgcactgtgacggcccgctcttcaagggcaagcgcgttgcggtcgttggcggtggt
aactcgggcgtagaagccgccatcgatctggcgggcatcgtcaaggacgtcacgctgatc
gaatacggtacccagttgcgcgccgacgaggtgctccagcgcaagctgcgcagcctgccc
aacgtacgtgtgctgatgaatgcgcaaacgaccgagatcgtcggtgacggtcagaaggtg
aacggcctgacctacctcaaccgggccacgggcgagcgttcgacgattgcgctcgaagga
gtgttcgtccagatcggtctggtgccgaacaccgaatggctcaagggcacggtgtcgctc
tcgcgtcatggagagatcgaagtcgatgccaagggcacgacctcggtgccgggcgtgttc
gccgcaggcgatgtgacgacggtgccgttcaagcaaatcgtgatcgccgtcggagaaggt
gcgaaggcgtcgctcggcgcgttcgaacacctgatgctcagctcggtcgacgacgaagtg
gacgccgagcggaacgaagccgctgtggcctga

DBGET integrated database retrieval system