KEGG   Paraburkholderia sprentiae: BJG93_06805Help
Entry
BJG93_06805       CDS       T04610                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pspw  Paraburkholderia sprentiae
Pathway
pspw00020  Citrate cycle (TCA cycle)
pspw00310  Lysine degradation
pspw00380  Tryptophan metabolism
pspw01100  Metabolic pathways
pspw01110  Biosynthesis of secondary metabolites
pspw01120  Microbial metabolism in diverse environments
pspw01130  Biosynthesis of antibiotics
pspw01200  Carbon metabolism
Module
pspw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pspw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJG93_06805
  09105 Amino acid metabolism
   00310 Lysine degradation
    BJG93_06805
   00380 Tryptophan metabolism
    BJG93_06805
Enzymes [BR:pspw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BJG93_06805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: APA85124
UniProt: A0A1I9YFP1
LinkDB All DBs
Position
1:complement(1531788..1534649)
Genome map
AA seq 953 aa AA seqDB search
MMKQFQSNSYLFGGNAPYVEEMYEAYLDNPASVPETWRSYFDALQNVPASDGSNANDVAH
GPIVESFAQRAKANAFLPRATAGGEDLATARKQVYVQSLIGAYRFLGSQWANLDPLKRRE
RPAIPELEPAFYDFTEADMDQEFSATNLYFGFERATLREIVKALRDTYCGTIGAEYMYIS
DPEQKRWWKERLESIRSTPNFSNEKKKHILNRLTAAEGLERFLHTKYVGQKRFSLEGGES
FIAAMDEVVRHGGLRGVQEIVIAMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAGD
VKYHKGFSSDVATEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDEDGLQVLPVQI
HGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDSRSTLYCSDVVKM
IEAPVLHVNGDDPEAVVMAIQMAIDFRTQFHKDVVVDIVCFRKLGHNEQDTPAVTQPLMY
KTISKHPGTRALYAEKLVQQGVITAEEGEEFVKAYRKAMDEGHHTVDPVLSNYKSKYAVD
WVPFLNRKWTDAADTAVPLAELKRLAERITTIPENFKVHPLVERVINDRRAMGRGEAKLD
WGMGEHLAFASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAEG
QAKFTVIDSVLSEEAVLGFEYGYSTAEPNTFVAWEAQFGDFVNGAQVVIDQFISSGEVKW
GRVSGLTMLLPHGYEGQGPEHSSARIERFLQLCADHNMQVVQPTTPAQVFHLLRRQMIRL
FRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVIGEVDEAIDAKKVKRVLACSGRVYYD
LIAHRREAKANDVAIIRIEQLYPFAHKQFEAEIKKYDNATEVVWVQDEPQNQGPWFYIEH
HLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALVEGAFGRLKSASIAK
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaattccagtcgaactcttatctgttcggcggcaatgctccgtacgttgaa
gaaatgtacgaagcgtatctcgataatccggcgtcagtgcccgagacctggcgcagctat
ttcgatgcgttgcagaacgtacccgcatcggacggcagcaacgccaacgacgtggcccac
ggccccatcgtcgaatcgtttgcacagcgcgccaaggccaatgcgttcctgccgcgcgca
acggccggcggcgaagatcttgcaactgcccgcaagcaggtttacgtccaatccctcatc
ggcgcatatcgcttcctcggctcgcaatgggccaatctcgatcctctgaagcgccgcgaa
cgtcccgcgatccccgaacttgaacccgcgttctacgacttcaccgaagccgacatggac
caggagttcagcgcaacgaatctgtacttcgggttcgagcgcgcgacgctgcgcgagatc
gtcaaagccctgcgcgatacgtactgcggcacgatcggcgccgagtacatgtacatcagc
gatccggagcagaagcgctggtggaaggaacgcctcgaatcgatccgttcgacgccgaac
ttcagcaacgaaaagaagaagcacatcctgaaccgcctgacggccgccgaaggcctcgag
cgtttcctgcataccaagtacgtcggtcagaagcgcttctcgctcgaaggcggcgagagc
ttcatcgcggcgatggacgaagtcgtgcgtcacggcggtctgcgcggcgtacaggaaatc
gtcatcgcgatggcgcaccgcggccgtctgaacgtgctggtcaacacgctcggcaagatg
ccggctgacctgttcgctgaattcgaaggcaagcacgtcgacgatctgccggctggcgac
gtgaagtaccacaagggcttctcgtcggacgtcgcgaccgaaggcggccccgttcatctg
tcgctcgcgttcaacccgtctcacctcgaaatcgtcaacccggtggtcgagggctcggcg
aaggcgcggatggaccgccgcggcgacgaagacggccttcaggtgctgccggtgcagatc
cacggcgacgcggctttcgcgggccagggcgtcgtgatggaaacgctgaacctcgcgcaa
acgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggcttc
acgacgtcggatccgcgcgactcgcgctccacgttgtactgctcggacgtcgtcaagatg
atcgaagcgccggtgctgcacgtgaacggtgacgatccggaggcggtcgtgatggccatc
cagatggcgatcgacttccgcacgcagttccacaaggacgtcgtcgtcgacatcgtctgc
ttccgcaagctgggccataacgagcaggacaccccggcggtcacgcagccgctgatgtac
aagacgatctcgaagcacccgggcacccgcgcgctgtacgctgaaaagctcgtgcaacag
ggcgtcatcacggccgaggagggcgaggagttcgtcaaggcctatcgcaaggcgatggac
gaaggccatcatacggtcgacccggtgctctcgaactacaagagcaagtacgcggtggac
tgggtgccgttcctgaaccgcaagtggaccgatgccgccgacacggccgtgccgctcgcg
gaactgaagcgcttggccgagcgcatcaccacgattccggaaaacttcaaggttcacccg
ctcgtcgagcgcgtgatcaacgaccgtcgcgcaatgggccgcggcgaagcgaagctcgac
tggggcatgggcgagcacctcgcgttcgcatcgctggtcgcatccggttatgccgtgcgc
ctgaccggtcaggattcgggccgcggcacgttcacgcaccgtcacgccgtgctgcacgac
cagaaccgcgagcgctggaacgacggcacctacgtgccgctgcagaacatcgccgaaggt
caggcgaagttcacggtgatcgactcggtgctgtcggaagaagcggtgctcggcttcgaa
tacggttactcgaccgctgaaccgaacacgttcgtcgcatgggaagcgcagttcggcgac
ttcgtgaacggcgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtgaagtgg
ggccgcgtgtcgggcctgaccatgctgctgccgcacggctacgaaggccagggtccggag
cactcgtcggcgcgtatcgagcgtttcctgcaactgtgcgcggaccacaacatgcaggtc
gttcaacctaccacgccggcgcaggtcttccacctgctgcgtcgccagatgatccgcctg
ttccgcaagccgctgatcgtcgcaacgccgaagtcgttgctgcgtcacaaggaagccgtg
tccgatctgtcggaactcgcgaagggctcgttccagccggtcatcggcgaagtggacgaa
gccatcgacgcgaagaaggtcaagcgcgtgctggcctgctcgggccgcgtgtactacgac
ctgatcgcgcatcgccgcgaagcgaaggcgaacgacgtcgcgatcatccgtatcgaacag
ctctatccgttcgcgcacaagcagttcgaagcggaaataaagaagtacgacaacgcaacg
gaagtcgtgtgggtgcaggacgagccgcagaatcagggcccgtggttctacatcgagcac
catctgaaggaaggtatgaaggaagggcaaaagctggcgtacagcggccgtccggcttcg
gcttcgcctgcggtcggctactacgcgaagcactatgaacagcagaaggcgctggttgaa
ggcgctttcggccgcctcaagagcgcgtcgatcgctaaataa

DBGET integrated database retrieval system