KEGG   Paraburkholderia sprentiae: BJG93_08480Help
Entry
BJG93_08480       CDS       T04610                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pspw  Paraburkholderia sprentiae
Pathway
pspw00020  Citrate cycle (TCA cycle)
pspw00480  Glutathione metabolism
pspw01100  Metabolic pathways
pspw01110  Biosynthesis of secondary metabolites
pspw01120  Microbial metabolism in diverse environments
pspw01130  Biosynthesis of antibiotics
pspw01200  Carbon metabolism
pspw01210  2-Oxocarboxylic acid metabolism
pspw01230  Biosynthesis of amino acids
Module
pspw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pspw_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJG93_08480
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BJG93_08480
Enzymes [BR:pspw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BJG93_08480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: APA85411
UniProt: A0A1I9YGH8
LinkDB All DBs
Position
1:complement(1923534..1925774)
Genome map
AA seq 746 aa AA seqDB search
MTTQRPTIIYTLTDEAPLLATAAFLPIIRSFTAPAGIEVQTSDISVAGRILGEFPECLTE
AQRVPDNLAELGRLTSLPDTNIIKLPNISASVPQLTSAIRELQAKGYKVPDYPEDPKTDE
QKAIRQRYSKCLGSAVNPVLREGNSDRRAPAAVKNYARKHPHSMAEWSMASRTHVAHMRH
GDFYHGEKSMTLDRARDVKMELVTKHGKTIVLKPKVALQDGEIIDSMFMSRKALLAFYEE
QMEDARKTGMMLSLHVKATMMKVSHPIVFGHAVKVFYKNAFAKHGKLFDELGVNVNNGLA
NLYEKLETLPESQREEVIRDLHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
LGGKMYGADGRPKDTKAVIPESTFARIYQEMINFCKTNGAFDPVTMGTVPNVGLMAQKAE
EYGSHDKTFEVPEDGEARIVDLASGEVLLTQNVEQGDIWRMCEVKDAAIRDWVKLAVTRV
RNSGTPAVFWLDPYRPHEAELIRKVETYLKDYDTTGLDIQIMSQVRAMRYTLERVVRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAASLEELGIKTGNDKAKILAKTLDTATGKLLDNNRSPSPKTGELDNR
GSQFYLAMYWAQELAAQTDDAALAAQFAPLATQLTANEQVIVAELASVQGAPADIGGYYM
PDADKLDEVMRPSRTFNEALKAVHVA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccagcgaccgaccatcatctacaccctcaccgacgaggccccgctgctcgcg
accgccgcgttcctgccaatcatccggagcttcacggcgccggccggcatcgaggtgcag
accagcgacatttcggtcgcgggccgcatcctcggcgagttccccgagtgtctgaccgaa
gcgcaacgggtgcccgacaacctcgcggaactcggtcgcctgacgtcgttgcccgacacc
aacatcatcaagctgcccaacatcagcgcatcggtgccgcaactgacgagcgcgatcagg
gaactgcaggcgaaaggctacaaggtgcccgactatccggaagatccaaagacggacgaa
cagaaggcgatccgtcaacgctactcgaagtgtctcggcagcgcggtgaacccggtgcta
cgcgaaggcaattcggaccgtcgcgcgccggccgcggtgaagaactacgcgcgcaagcat
ccgcacagcatggccgaatggagcatggcgtcgcgcacgcacgtcgcgcacatgcggcac
ggcgacttctatcacggtgaaaaatcgatgacgctcgaccgcgcgcgcgacgtgaagatg
gaactcgtcacgaagcacggcaagacgatcgtgctgaagccgaaggtcgcgctgcaggac
ggcgagatcatcgacagcatgttcatgagcaggaaggcgctgctcgcgttctatgaagag
cagatggaagacgcgcgcaaaaccggcatgatgctgtcgctgcacgtgaaggcgacgatg
atgaaggtgtcgcacccaatcgtcttcggccacgcggtgaaggtgttctacaagaacgcg
ttcgcgaagcacggcaagctgttcgacgaactcggcgtgaacgtcaacaacggactcgcc
aatctttacgagaagctcgagacgctgccggaatcgcagcgcgaggaagtcatccgcgac
ctgcacgcgtgccacgaacatcgtccggaattggcgatggtcgattcggcgaagggcatc
tcgaacctgcatgcgccgaacgacgtgatcgtcgacgcgtcgatgccggcgatgatccgc
ctcggcggcaagatgtatggcgccgacggtcgtccgaaagataccaaggcggtgatcccc
gagagcaccttcgcgcgtatctaccaggagatgatcaacttctgcaagaccaacggcgcg
ttcgatccggtcacgatgggcaccgtgccgaacgtcggcctgatggcgcagaaggcggaa
gaatacggctcgcacgacaagaccttcgaagtgcccgaggacggcgaggcgcgcatcgtc
gatctcgcgagcggcgaggtgctgctcacgcagaacgtcgagcagggcgacatctggcgc
atgtgcgaggtgaaggacgcggcgatccgcgattgggtcaaactcgcggtcacgcgcgtg
cgcaattccggcacgcccgcggtgttctggctcgatccgtatcgtccgcacgaagcggag
ctgatcaggaaggtcgagacctacctgaaggattacgacaccacgggtctcgacatccag
atcatgtcgcaggtacgcgcgatgcgttacacgctcgagcgcgtggtgcgcgggctcgat
acgatctcggtcaccggcaacatcctgcgcgattatctgaccgacctgttcccgatcatg
gagcttggcaccagcgcgaagatgctgtcgatcgtgccgttgatggcgggcggcggcatg
tacgagaccggcgcgggcggttcggcgccgaagcacgtcaagcagctcgtcgaagagaac
catctgcgctgggactcgctgggcgaatttctcgcgctcgcggcgtcgctcgaagaactg
ggcatcaagaccggcaacgacaaagcgaagatcctcgcgaagacgctcgacaccgcgacc
ggcaagctgctcgacaacaaccgcagcccgagcccgaagaccggcgagctcgacaatcgc
ggcagccagttctatctggcgatgtactgggcacaggagctggccgcgcaaacggacgat
gcggcgctcgccgcgcagttcgcgccgctcgcgacgcaactgaccgccaacgagcaggtg
attgtcgcggagctggcctcggtgcagggcgcgcccgcggacatcggcggctattacatg
ccggacgccgacaagctcgatgaggtgatgcggccgagccgcaccttcaacgaggcgctg
aaggcggttcacgtcgcgtaa

DBGET integrated database retrieval system