KEGG   Paraburkholderia sprentiae: BJG93_16500Help
Entry
BJG93_16500       CDS       T04610                                 

Definition
(GenBank) nif-specific transcriptional activator NifA
  KO
K02584  Nif-specific regulatory protein
Organism
pspw  Paraburkholderia sprentiae
Pathway
pspw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BJG93_16500
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pspw03000]
    BJG93_16500
Transcription factors [BR:pspw03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    BJG93_16500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Sigma54_activ_2 GAF HTH_8 AAA_5 GAF_2 AAA Mg_chelatase GAF_3 AAA_3 MCM AAA_2 AAA_30 TIP39 HTH_23 AAA_16
Motif
Other DBs
NCBI-ProteinID: APA89104
UniProt: A0A1I9YT50
LinkDB All DBs
Position
2:complement(8270..10105)
Genome map
AA seq 611 aa AA seqDB search
MQHNTRKSEQGDREDGPNNGDVVMLHIASVRERRISKSETDHAVPIVQWYESALTGILEI
SKVLTAPCRLEVMLANVVDLLQSFVQMRLGIVSLFDDDGVPDITVGAGWGEGSDERYRMR
LPQKAIDQIMATDRPLVAEDVAVHSGFSTADMGVLGASDNVRVSFIGVPIRIDAKVVGTL
TIDRILDNGANLRLDYDVQLLSMMANLVGQTVKLHRLFKSDRDRLMAGRDGLQKQLSELK
YPAQERKKFQVEGIIGDSPALRGLLEKIAVVAKSNSTVLLRGESGTGKELVAKALHELSP
RAKRPFIKLNCAALPETVLESELFGHEKGAFTSAFNSRKGRFELADKGTLFLDEIGEISA
SFQAKLLRVLQEQEFERVGSNQTIKVDVRVIAATNKNLEDAVARNEFRADLYYRISVVPL
LLPPLRERRSDIPLLAVEFLKNFNSENGRTLTFDASAIEVLMNCGFPGNVRELENCVQRS
ATLAPGPAIVRNDFGCCHGQCLSALLWKSGSDEIALQPGRIVPVPGKPATPRVEAVTSGA
IAVQPVGSERAPLTAGGAVLGSDAKMTNRERLIAAMERSGWVQAKAARLLGLTPRQIGYA
LRKYGVEIKRL
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacaatactcgtaaatccgaacaaggtgacagggaggatggccccaacaacgga
gacgtcgtcatgctgcatatcgcttccgtacgcgaaaggcgtatctcaaagtccgagacg
gaccacgcggtccctattgtgcagtggtacgagagcgcgcttaccggcatcttggaaata
tcgaaggtactcaccgccccctgccggctcgaagtcatgttggccaacgtcgtcgatctc
ctgcaatcgtttgtgcagatgcggctcggtatcgtctctctcttcgacgatgatggcgta
ccggatattaccgttggtgccggctggggcgaaggcagcgatgagcgctaccggatgcgc
ctgccgcagaaggcaattgaccagatcatggcgacggacaggccgctcgtcgccgaagac
gtagcggtgcattcgggcttcagtaccgccgacatgggcgtgctcggtgcttccgacaac
gtgcgagtgtcgttcatcggcgttcctattcgcatcgacgcaaaagtcgtgggcacgctg
accatcgaccgcatcctggataacggggcgaatctccggctcgattacgacgtgcagctg
ctttccatgatggccaacctagtggggcagacggtgaagctgcatcgcttatttaagagc
gaccgcgaccgactgatggcggggagggacgggctgcaaaaacaattgtccgagctcaag
taccctgcacaggagcgtaagaagtttcaggtcgaggggatcattggcgacagcccggcg
ctgcgcggcctgctcgagaagatcgcggtggtagctaaatcgaacagcacagttctcttg
cgcggggaatccggtaccgggaaggagctggtcgccaaggcccttcacgagctgtcgccg
cgagccaagcggcccttcatcaagctcaattgcgcggcgctccctgagacggtgctggaa
tccgaattgttcggtcatgagaagggtgcctttaccagcgccttcaattcgcgcaagggg
cgcttcgaactcgccgacaaggggacgctgtttctggacgagatcggcgagatctcggcc
tcgttccaggcaaagctgctgcgcgtcctgcaggagcaagaattcgagcgagtcggcagc
aaccagaccattaaggtcgatgttcgcgtgattgccgccacgaataagaacctggaagac
gcggtggcaaggaacgagttccgcgccgacctttattatcgcatcagcgtggttcccttg
ctgctgccgccgttgcgtgaaaggcgcagtgatattccgctcctcgccgttgagtttctc
aagaatttcaacagcgagaacggccgtaccctgaccttcgatgcgagtgcgattgaagta
ttgatgaactgcggttttcccggcaatgtccgcgagctcgaaaattgcgtgcagcgaagc
gcgaccttggcgccgggaccagcgatcgtgagaaacgactttggttgctgccacggccag
tgcctgtccgcgctgctgtggaagagcggatcggacgaaatcgcgctgcagcccgggcga
atcgtaccagtgcccgggaagccggctacgcctcgggttgaggctgttacgtcgggcgca
attgcggtccagcctgtcggcagcgagagggctccgttaacggctggtggggcagtcctc
ggaagtgatgcgaagatgaccaaccgcgagcgtctcatcgccgccatggaaagatccggc
tgggtgcaggcaaaggcggcgcggctgcttggactgacgccgcgccagattggctacgcg
ctgagaaaatacggtgtcgagatcaagcgtctctga

DBGET integrated database retrieval system