KEGG   Paraburkholderia sprentiae: BJG93_18350Help
Entry
BJG93_18350       CDS       T04610                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pspw  Paraburkholderia sprentiae
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pspw01001]
    BJG93_18350
Enzymes [BR:pspw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BJG93_18350
Protein kinases [BR:pspw01001]
 Serine/threonine kinases: Other
  Bacterial family
   BJG93_18350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Pkinase_fungal RIO1
Motif
Other DBs
NCBI-ProteinID: APA87457
UniProt: A0A1I9YMC4
LinkDB All DBs
Position
2:complement(431098..432555)
Genome map
AA seq 485 aa AA seqDB search
MSNEATPTRIGKYRIDRVLGTGAMGVVYLAFDPHLERPVALKTVRRELLAGEDTSGDMLL
RFRNEARAAGRLAHPNIVTVHDFGEDGGTAYIVMEYVAGHGLDTLLVPGHALPLSEAFHW
LAQLLAALAYAHEAGVVHRDIKPANLLVTAAGLLKVADFGVARIGSSATSSGWMIGTPSY
MSPEQFEGESVDARADLFSAGVVLYRMLTGRQPFVGSPATIRQKIIKDAPARPSEIVSAL
PPALDAMVAKALARRPDDRFGSAAEWLASLRSLAVSPAAADDDRTIVTPSVYWSASASLP
AHATGVGPAPVPVPSAPPSWPPEMLARIERQLATQMGPLASLLVRRAATQTNDLPTLGAQ
LAAALPDTARLEFEQAFARLTAGLPDMSTMTSSSPGSRVATAAAKVSAVSPASAAGTSPD
SAIDQASIDAVAVKLAVYLGPIAKMIASREARHAANFDEFVQRVEDCITDPAQRGRFRHD
VDSSG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgaagcaacgcctacgcgcattggcaagtaccggatcgaccgcgtgctgggg
acgggcgccatgggcgtcgtctatctcgcgttcgacccgcacctggaaagaccggtggcg
ctgaaaaccgtgcgtcgcgaactgctcgccggcgaggacacgagtggcgacatgctgctg
cgttttcgcaacgaggcacgcgcggccggtcggctcgcgcatccgaacatcgtcacggtc
cacgatttcggcgaagacggcggtacggcttatatcgtgatggagtacgtcgccgggcat
ggcctcgatacattgctggtgccgggccacgcgttgccgctgtcggaggctttccactgg
ctcgcgcaactgctcgccgcgctcgcgtatgcgcatgaggccggcgtcgtgcaccgcgat
atcaagccggcgaatctgctcgtcacggcggcggggcttctgaaggtcgccgattttggc
gtcgcgcgcatcggctcatccgccacctcgtccgggtggatgatcggcacgccgagctac
atgtcgcccgagcagttcgagggcgaatcggtcgatgcccgcgcggacctgttctcggcc
ggcgtcgtgctgtaccgcatgctgaccggccgccagccgttcgtcggctcgccggccacg
atcaggcagaagatcatcaaagatgcgccggcccggccatcggaaatcgtctccgcgttg
ccgccggcgctcgacgcgatggtcgcgaaagcactcgcgaggcggccggacgaccgcttc
ggttcggccgcggaatggctcgcgagcttgaggtcgttggccgtctcgccggcggcggcc
gacgatgaccggactatcgtgacgccgtccgtgtattggtccgcgtccgcttccttgcca
gcgcatgcgacgggcgtcggccccgcacctgtgcccgtgccttcggcgccgccgagttgg
ccgcctgagatgctcgcgcgcatcgaacgccaactcgcgacccagatgggcccgctcgcg
agccttctggtgcgacgcgcggccacccagacgaacgacctgccgacgctcggcgcgcag
ctggcggcggcgttgccggacacggcgcggcttgaattcgagcaggccttcgcgcggctg
acggctggcttgcccgatatgtcgacgatgacctcgtcatcgccgggctcacgcgtcgcg
acggctgccgcaaaggtatcggctgtatcgcccgcgagcgccgcaggcacgtcaccagac
agtgcgatcgatcaggccagcatcgatgccgtcgccgttaaactggccgtctatctggga
ccgatcgctaagatgattgccagtcgcgaggcgcggcatgctgcgaatttcgacgagttc
gtccagcgggtcgaggactgcatcaccgaccccgcgcaacgcggtcgattccggcacgat
gtcgattcatccggttag

DBGET integrated database retrieval system