KEGG   Paraburkholderia sprentiae: BJG93_19470Help
Entry
BJG93_19470       CDS       T04610                                 

Definition
(GenBank) ribulose-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pspw  Paraburkholderia sprentiae
Pathway
pspw00630  Glyoxylate and dicarboxylate metabolism
pspw01100  Metabolic pathways
pspw01120  Microbial metabolism in diverse environments
pspw01200  Carbon metabolism
Module
pspw_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BJG93_19470
Enzymes [BR:pspw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BJG93_19470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: APA87652
UniProt: A0A1I9YMW9
LinkDB All DBs
Position
2:complement(694181..695680)
Genome map
AA seq 499 aa AA seqDB search
MNDFSQPPIQPEPHARDPLNPRERYAAGVMKYREMGYWQPDYEPKDTDVIALFRITPQPG
VEPEEAAAAVAGESSTATWTVVWTDRLTACDMYRAKAYRVEPVPVSRADEPQYFAYIAYE
LDLFEEGSVANLTASIIGNVFGFKPLKALRLEDMRIPVAYLKTFQGPPTGIVVERERLDK
YGRPLLGATVKPKLGLSGKNYGRVVYEGLRGGLDFLKDDENINSQAFMHWRDRFLFAMDA
VNRAQAETGELKGHYLNVTAGTMEDMYERAEFAKELGSCIVMIDLVIGWTAIQSMSRWAR
RNDMILHLHRAGHGTYTRQRNHGISFRVIAKWLRMAGVDHAHAGTAVGKLEGDPLSVQGY
YNVCRDAHNTVDLSRGIFFDQPWAGLRKVMPVASGGIHAGQMHQLLDLFGDDAILQFGGG
TIGHPAGIQAGATANRVALEAMVKARNEGRDILREGPDVLEAAARWCTPLKQALDTWRDV
TFNYASTDTPDFAATPTAA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatttcagtcaaccgccgatccagcccgaacctcatgcgcgcgatccgctcaat
ccgcgcgagcggtacgcggcaggcgtgatgaaataccgcgagatggggtactggcaaccg
gactacgaaccgaaagacaccgatgtgatcgcgctctttcgcatcacgccgcaacccggt
gtcgaacccgaggaagcggcggccgcggtggccggcgaatcgtcgaccgcgacgtggacg
gtggtgtggaccgaccggctcaccgcctgcgacatgtatcgcgcgaaggcgtatcgcgtc
gagccggtgccggtttctcgcgccgacgaaccgcagtacttcgcgtacatcgcttatgaa
ctcgatctgttcgaagagggctcggtcgcgaacctgaccgcgtcgatcatcggcaacgtg
ttcggcttcaagccgctgaaggcgttgcggctcgaagacatgcgcattcccgtcgcgtat
ctgaagaccttccaggggccgccgaccggcatcgtcgtcgagcgcgaacggctcgacaaa
tatggacggccgctgctcggcgccacggtcaagccaaagctcggtctgtcaggcaagaac
tatggacgcgtggtctacgaaggcctgcgcggcggcctcgatttcctgaaggacgacgag
aacatcaactcgcaggcgttcatgcattggcgcgaccgcttcctgttcgcgatggacgcg
gtgaaccgcgcccaggccgaaaccggcgagctcaaagggcattaccttaacgtgacggcc
ggcacgatggaggacatgtacgagcgcgccgaattcgccaaggaactgggttcctgcatc
gtgatgatcgacctcgtgatcggctggaccgcgatccagtcgatgtcgcgctgggctcgc
aggaacgacatgatcctgcacctgcatcgcgcggggcatggcacgtacacgcggcaacgc
aaccacggcatctcgtttcgcgtgatcgccaaatggctgcgcatggcgggcgtcgaccac
gcacatgcgggtaccgcggtcggcaagctcgaaggcgatccgctgtcggtgcagggctac
tacaacgtgtgccgcgacgcgcacaacacggtcgatctgtcgcgcggcattttcttcgat
caaccatgggccggcttgcgcaaggtgatgccggtcgcctcgggcgggattcacgcgggg
cagatgcatcagctgctggacctgttcggcgacgacgcgatcctgcagttcggcggcggc
acgatcggccatccggccggcatccaggccggcgcgaccgcgaaccgcgtcgcactcgaa
gcgatggtgaaggcgcgcaacgagggccgcgacattctgcgcgaagggcccgacgtgctc
gaagccgccgcgcgctggtgcacgccgctcaagcaggcgctcgatacatggcgcgacgtg
actttcaactacgcatcgaccgatacgcccgatttcgccgccacgccgacggcggcctag

DBGET integrated database retrieval system