KEGG   Paraburkholderia sprentiae: BJG93_19705Help
Entry
BJG93_19705       CDS       T04610                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pspw  Paraburkholderia sprentiae
Pathway
pspw00061  Fatty acid biosynthesis
pspw00780  Biotin metabolism
pspw01100  Metabolic pathways
pspw01130  Biosynthesis of antibiotics
pspw01212  Fatty acid metabolism
Module
pspw_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BJG93_19705
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BJG93_19705
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BJG93_19705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pspw01004]
    BJG93_19705
Enzymes [BR:pspw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BJG93_19705
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BJG93_19705
Lipid biosynthesis proteins [BR:pspw01004]
 Fatty acid synthase
  Component type
   BJG93_19705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: APA87696
UniProt: A0A1I9YN13
LinkDB All DBs
Position
2:complement(737635..738417)
Genome map
AA seq 260 aa AA seqDB search
MPVEQSRLILEGAKALVTGVANEASIAYGCAKAFHELGASVALTYANDKAMPHVEPIAKA
LDAEIFMPLDVTGEDQMEAVFDRIEKTWGRLDILVHAIAWAPKADLHGGLLRSSREGFLS
AMDISCHSFVRMARLAAPLMKDGGTMLTMSYYGANKVVPNYNLMGPVKAALEACARYLAF
ELGPNGIRVHAISPGPLKTRAASGLKDFELLLNEAVQRAPIGELADIMDVGYSCAFLATP
YARRLSGSTLYIDGGLNIVA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcgagcaatcgcgtttgattctggaaggagcaaaggctctcgtgaccggcgtc
gccaacgaagcttcgattgcctatggttgcgcgaaggcgtttcacgaactcggcgcaagc
gttgcgctcacctatgcgaacgacaaggcgatgccgcatgtggaaccgattgcgaaagca
ctcgatgccgagatcttcatgccgctcgacgtaacgggcgaggaccagatggaggccgtg
ttcgatcggatcgaaaagacgtgggggcgtctcgatattctcgttcacgcgattgcctgg
gcgccgaaagcggatttgcatggcggactgctgcgatcgtcgcgcgaaggcttcctgagc
gcgatggacatctcctgtcattcgttcgtgcggatggcgcgccttgccgcgccgctgatg
aaagacggcggcaccatgctgacgatgagctactacggcgcgaacaaggtcgtgccgaac
tacaacctgatgggccccgtcaaggcggcgctcgaggcctgcgcgcgctatctcgcgttc
gaactggggccgaacggcatccgcgtgcacgcgatatctcccgggccgctgaagacccgc
gccgcttcgggcttgaaggatttcgagctgctgctcaacgaagcggtgcagcgcgcgccg
atcggcgaactggccgacatcatggacgtcggttatagctgcgcgtttctggccacgccg
tatgcgcggcggctttccggttccacgttgtatatcgacggcggactgaacatcgtggca
tag

DBGET integrated database retrieval system